DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and T15B7.1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:223 Identity:60/223 - (26%)
Similarity:105/223 - (47%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFF-RSWAEYKNGFGQLD--GDFFIGLD 150
            |.||:.|.| |..:|.||.:..|.||.:...|..:..::: |.|.|||||||.:|  .:|::|.:
 Worm   158 GTYTILVNG-KETEVWCDMQTYGGGWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNE 221

  Fly   151 KLHAITKSQPHELYIHLEDFEGQTR---------YAHYDEIFIESENKFYAMTKLG-EFTGDAGD 205
            .||.:|.::  ::.:.:|.:..:|.         :.||.:..:.|:.:.|.:..|. ::....|:
 Worm   222 ALHVMTTNK--KVTLRVEMYGDRTPNSKNATDFWFGHYFDFQVGSKTQNYPLLDLTMDWANPIGN 284

  Fly   206 S------MIHNRNQNFSTFDRDNDGWHKNCAEEY-VGAWWHLNCTYSNLFGIYVKGD----EGQY 259
            :      :..:....|||.|..:|. .|.|..:: :|.||..||..|.|.|.|...|    .|.:
 Worm   285 ASTAWYDLTCSIGSPFSTIDNIHDP-VKECVTKFQMGGWWLKNCALSTLNGAYTPKDWNNGYGMF 348

  Fly   260 FQWKG--IVWHSWRTESYSYKVMQMMVR 285
            :.|.|  .:.|..:|        :|::|
 Worm   349 WIWDGSDTILHPKKT--------RMLLR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 60/223 (27%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 59/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I3641
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.