DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and C49C8.5

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_501481.2 Gene:C49C8.5 / 177668 WormBaseID:WBGene00016769 Length:451 Species:Caenorhabditis elegans


Alignment Length:236 Identity:54/236 - (22%)
Similarity:97/236 - (41%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SDLNTTGLSGRYPSQCPTYPP----------------AHGIYTVQVLGLKPFQVSCDAEIAGTGW 114
            |:..||.::|..|:..||.||                :.|:.|:...|..|..|.||.:.:...:
 Worm   164 SETTTTEITGTTPTPGPTEPPTTTAKLPSDCDEVESTSSGLQTIYPDGSTPVSVYCDRKNSAGAY 228

  Fly   115 TVMAR--RTSNKLNFFRSWAEYKNGFGQ--LDGDFFIGLDKLHAI-TKSQPHELYIHL---EDFE 171
            |::..  |..:.:.|...:|.|.:.||:  :..:|::|||.::.: |..:.:.|.|.|   ....
 Worm   229 TIIQSRGREGSNITFDIPFANYSDWFGESGVGKNFWLGLDNMNNLSTNGKTYSLQIDLCCGTQLM 293

  Fly   172 GQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGD--SMIHNRNQNFST----------------- 217
            .:..|.::.   :.::.:.||:|...:..|...|  |...:....|||                 
 Worm   294 AKQLYTNFK---VATKAEQYALTASADLPGIGLDYSSSAKDLGAPFSTQLTYSLPKGKAECDQFE 355

  Fly   218 -FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEG 257
             :|.||.|  ...::.| |.||:.:|. :||.|.....:.|
 Worm   356 FYDDDNGG--AGPSKGY-GGWWYGSCG-NNLNGFLYPNNNG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 50/226 (22%)
C49C8.5NP_501481.2 FReD 190..437 CDD:294064 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.