DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fgl2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_032039.2 Gene:Fgl2 / 14190 MGIID:103266 Length:432 Species:Mus musculus


Alignment Length:317 Identity:102/317 - (32%)
Similarity:154/317 - (48%) Gaps:60/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EAMDSESFQNDTAIRN-KPELKSLYKLVLALLEENQSNASTEN-IQKSSSDLN--TTGLSGRYPS 79
            :.::|:..:..:.::| |.:::.|...:..|...|.:|  .|| :....::|.  ...|.|:. |
Mouse   124 QELESQVNKLSSELKNAKDQIQGLQGRLETLHLVNMNN--IENYVDNKVANLTVVVNSLDGKC-S 185

  Fly    80 QCP------TYPPAHGIY----TVQVLGLK--------------PFQVSCDAEIAGTGWTVMARR 120
            :||      :.|..|.||    ...|||.:              .|:|.||.|..|.||||:..|
Mouse   186 KCPSQEHMQSQPVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQAR 250

  Fly   121 TSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIE 185
            .....||.|.|.:||.|||.|:.:|::|.||:|.:|||:...|.|.||||.|.|.||.||:.::.
Mouse   251 LDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVA 315

  Fly   186 SENKFYAMTKLGEFTGDAGDSMIHNRNQN-----FSTFDRDNDGWHK-NCAEEYVGAWWHLNCTY 244
            :|...|.: .:|.:.|.|||::..:|:.|     |:|.|||||.:.. ||...|...||..:|..
Mouse   316 NEFLKYRL-HIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLS 379

  Fly   245 SNLFGIYVKGDEGQYFQWK------GIVWHSW------RTESY--SYKVMQMMVRPK 287
            :||        .|:|:..|      ||.|.:|      :...|  |:|..:||:|||
Mouse   380 ANL--------NGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 88/254 (35%)
Fgl2NP_032039.2 Uds1 72..151 CDD:292096 4/26 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Fibrinogen_C 202..428 CDD:278572 83/234 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.