DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fcnb

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:249 Identity:73/249 - (29%)
Similarity:108/249 - (43%) Gaps:38/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QSNASTENIQKSSSDLNTTGLSGRYPSQ-CPTYP--------PAH---GIYTVQVLGLKPFQVSC 105
            :.|...:.|:....|      ||  ||| |.|.|        ..|   |.||:.:...:|..|.|
Mouse    78 KGNQGEKGIRGEKGD------SG--PSQSCATGPRTCKELLTQGHFLTGWYTIYLPDCRPLTVLC 134

  Fly   106 DAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDF 170
            |.:..|.||||..||....::|||.|..||.|||...|:|::|.|.:||:|.....||.:.|.||
Mouse   135 DMDTDGGGWTVFQRRLDGSVDFFRDWTSYKRGFGSQLGEFWLGNDNIHALTTQGTSELRVDLSDF 199

  Fly   171 EGQTRYAHYDEIFIESENKFYAMTKLGEF----TGDAGDSMIHNRNQNF-----STFDRDNDGWH 226
            ||:..:|.|....|:.|.:.|.:. ||.|    .|.|..|:..::|.:.     |...:.|....
Mouse   200 EGKHDFAKYSSFQIQGEAEKYKLI-LGNFLGGGAGPAFPSVTISQNLSVTNPLRSQISQSNHLTL 263

  Fly   227 KNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWK--GIVWHSWRTESYSYK 278
            |.|......:      ||:...|.::...:...|..:  |:...|:|....:|:
Mouse   264 KQCLPSTKPS------TYNTFRGCFISKPQQHVFPRRTCGLGSASYRVHPTAYE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 68/226 (30%)
FcnbXP_006497739.1 Collagen 40..95 CDD:189968 5/24 (21%)
FReD 103..>238 CDD:238040 49/135 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm42379
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.