DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angpt2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_031452.2 Gene:Angpt2 / 11601 MGIID:1202890 Length:496 Species:Mus musculus


Alignment Length:314 Identity:93/314 - (29%)
Similarity:136/314 - (43%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SFYSTEAMDSE---SFQNDTAIRNKPELK---SLYKLVLALLEENQSNASTEN--IQKSSSDLNT 70
            ||...:.:|.|   |.|..:....|.||:   |....|:..||:....|:..|  :||...||..
Mouse   189 SFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLME 253

  Fly    71 T---------------GLSGRYPSQCPTYPPAH---------GIYTVQV-LGLKPFQVSCDAEIA 110
            |               .::.|...|......|.         ||||:.. ...:..:..||.::.
Mouse   254 TVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVG 318

  Fly   111 GTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTR 175
            |.||||:..|....::|.|:|.|||.|||...|::::|.:.:..:|....:.|.|.|:|:||...
Mouse   319 GGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEA 383

  Fly   176 YAHYDEIFIESENKFYAMTKLGEFTGDAGD-SMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWH 239
            ::.||..::..|...|.:...| .||.||. |.|.....:|||.|.|||.....|::...|.||.
Mouse   384 HSLYDHFYLAGEESNYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWF 447

  Fly   240 LNCTYSNLFGIYVKGDEGQYF-------QWKGIVWHSWRTESYSYKVMQMMVRP 286
            ..|..|||        .|||:       ::.||.|:.|:...||.|...||:||
Mouse   448 DACGPSNL--------NGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 73/229 (32%)
Angpt2NP_031452.2 RILP-like <168..226 CDD:304877 10/36 (28%)
FBG 280..494 CDD:214548 71/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.