DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angpt1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_571888.1 Gene:angpt1 / 114407 ZFINID:ZDB-GENE-010817-1 Length:513 Species:Danio rerio


Alignment Length:275 Identity:85/275 - (30%)
Similarity:139/275 - (50%) Gaps:27/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SESFQNDTAI-RNKPELKSLYKLVLALLEENQSNASTENIQKSS---------SDLNTTGLSGRY 77
            |.:..|.||: |.:.:|....:.:|:|..::.:.|...|..|.:         :||...|..   
Zfish   249 SRATGNSTALQRQQQDLMESMRSLLSLCAKDAATAVEPNSTKQADEERKFRDCADLYQAGFQ--- 310

  Fly    78 PSQCPTYPPAHGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLD 142
                     .:|:||:.:...:..:|.|..|.||.||||:.:|....::|.::|.|||.|||.:.
Zfish   311 ---------KNGVYTINISPQETKKVYCVMESAGGGWTVIQKREDGTVDFQKTWKEYKMGFGSVS 366

  Fly   143 GDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAG-DS 206
            |:.::|.:.:|.:|..:.|.|.:.|.|::|...::.||...|:||.:.|.:. |...:|.|| .|
Zfish   367 GEHWLGNEFVHVLTNQRQHGLRVELSDWDGHQAFSQYDSFHIDSEKQKYRLF-LKTHSGTAGRQS 430

  Fly   207 MIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYF-QWKGIVWHSW 270
            .:.....:|||.|.|||.....||....|.||:..|..|||.|:|.:  :||:. ::.||.||.:
Zfish   431 SLAVHGADFSTKDVDNDNCTCKCALMLSGGWWYDACGPSNLNGVYYR--QGQHVGKFNGIKWHYF 493

  Fly   271 RTESYSYKVMQMMVR 285
            :..|||.:...||:|
Zfish   494 KGPSYSLRSTVMMIR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 71/212 (33%)
angpt1NP_571888.1 RILP-like <206..272 CDD:304877 6/22 (27%)
FReD 298..508 CDD:238040 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.