DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fcnb

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:236 Identity:94/236 - (39%)
Similarity:124/236 - (52%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DLNTTGLSGRY----PSQ-CPTYPPA-----------HGIYTVQVLGLKPFQVSCDAEIAGTGWT 115
            |....|:.|..    ||| |.|.|..           .|.||:.:...:|..|.||.:..|.|||
  Rat    85 DRGEKGVRGEKGDTGPSQSCATGPRTCKELLTRGYFLTGWYTIYLPDCRPLTVLCDMDTDGGGWT 149

  Fly   116 VMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYD 180
            |..||....::|||.|..||.|||...|:|::|.|.:||:|....:||.:.|.||:|...:|.|.
  Rat   150 VFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHDFAKYS 214

  Fly   181 EIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTY 244
            ...|:.|.:.|.:. ||.|. |.||||:....|..|||.|:|||....|||..|.||||:.:|..
  Rat   215 SFQIQGEAEKYKLI-LGNFLGGGAGDSLTSQNNMLFSTKDQDNDQGSSNCAVRYHGAWWYSDCHT 278

  Fly   245 SNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVR 285
            |||.|:|::|....|.  .|:.|.||:..:|||||.:|.||
  Rat   279 SNLNGLYLRGLHKSYA--NGVNWKSWKGYNYSYKVSEMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 91/227 (40%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106 7/20 (35%)
FReD 108..317 CDD:238040 84/211 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.