DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and FGL2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens


Alignment Length:334 Identity:105/334 - (31%)
Similarity:158/334 - (47%) Gaps:69/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLSFYSTEA-----------MDSESFQNDTAIRN-KPELKSLY----KLVLALLE--ENQSNAST 58
            ||...||.|           ::||..:..:.::| |.|:..|:    ||.|..:.  ||..::..
Human   113 GLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKV 177

  Fly    59 ENIQKSSSDLNTTGLSGRYPS--QCPTYPPAHGIY------------TVQVLGLKP------FQV 103
            .|:....:.|:  |...:.||  |..:.|..|.||            :.:...:.|      |:|
Human   178 ANLTFVVNSLD--GKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEV 240

  Fly   104 SCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLE 168
            .||.|..|.||||:..|.....||.|:|.:||.|||.|..:|::|.||:|.:|||:...|.|.||
Human   241 YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLE 305

  Fly   169 DFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQN-----FSTFDRDNDGWHK- 227
            ||.|...||.||:.::.:|...|.: .:|.:.|.|||::..|::.|     |:|.|:|||.:.. 
Human   306 DFNGVELYALYDQFYVANEFLKYRL-HVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSG 369

  Fly   228 NCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWK------GIVWHSWR--TESY------SYK 278
            ||...|...||...|..:||        .|:|:..|      ||.|.:|.  :|::      |:|
Human   370 NCGLYYSSGWWFDACLSANL--------NGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFK 426

  Fly   279 VMQMMVRPK 287
            ..:||:|||
Human   427 EAKMMIRPK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 84/250 (34%)
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126 5/12 (42%)
FReD 209..435 CDD:294064 79/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.