DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and si:zfos-2330d3.6

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_009294456.1 Gene:si:zfos-2330d3.6 / 103909555 ZFINID:ZDB-GENE-110411-23 Length:242 Species:Danio rerio


Alignment Length:224 Identity:78/224 - (34%)
Similarity:123/224 - (54%) Gaps:11/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LSGRYPSQC----PTYPPAHGIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMARRTSNKLNFF 128
            :||..|..|    .:.....|:|::...|..|..|.|....:|.     ||||..||....:|||
Zfish    18 VSGFKPFDCSEIYKSGKTLSGVYSIYPAGNIPASVYCQMISSGKGGENGGWTVFQRRMDGSVNFF 82

  Fly   129 RSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAM 193
            |.|.|||.|||.::|::::||:.|:.:|:.:...|.:.||||||:..:|.|....:.||.:.|.:
Zfish    83 RPWEEYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKGFAQYSSFSVGSEAEGYKL 147

  Fly   194 TKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQ 258
            ...|...|.||||:|::....|:|:|:|.|...:|||..||||:|:.:|..:|..|:|:.|::..
Zfish   148 QVSGFTNGGAGDSLIYHSGMKFTTYDKDQDTHTQNCARIYVGAFWYKDCHNANPNGVYLGGEDKT 212

  Fly   259 YFQWKGIVWHSWRTE-SYSYKVMQMMVRP 286
            .|. .|.||::|:.. ....|.:.|.::|
Zfish   213 LFA-IGNVWYTWKNNFEIGMKFITMKIKP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 76/221 (34%)
si:zfos-2330d3.6XP_009294456.1 FReD 23..241 CDD:238040 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.