DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:301 Identity:92/301 - (30%)
Similarity:148/301 - (49%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LKSLYKLVLALLEENQSNASTENIQKSSSDL-NTTGLSGR-----------------YPSQCPTY 84
            |.:...|:.|:|.|...:..::.:::.::.| :..|.:|.                 ...:.||.
Zfish    94 LVAFLALMAAVLTECNLHCHSQRLREMATRLESVVGKNGEKDLLLLLKSITHSKPNSLKPRTPTV 158

  Fly    85 PPA------------------HGIYTVQVLGLKP-FQVSCDAEIAGTGWTVMARRTSNKLNFFRS 130
            ||:                  :||||:|....:| .:..||...||.||||..||...|.:|.|:
Zfish   159 PPSAGLYPQDCHEIYQLGIKENGIYTIQPDPKQPALEAVCDMVSAGGGWTVFQRRFDGKTDFNRT 223

  Fly   131 WAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTK 195
            |.||::|||....:.::|...|:|:|.:..|.|.|.|:|:..|||:|:|:...:..||:.:.:| 
Zfish   224 WQEYRDGFGSPQTEHWLGNAVLYALTANGQHTLRITLQDWHEQTRHANYNNFKVAGENQRFRLT- 287

  Fly   196 LGEFTGDAGDSMIHNRNQN-----FSTFDRDNDGWHK-NCAEEYVGAWWHLNCTYSNLFGIYVKG 254
            ..|:.||||::..:::..|     |||:|||:|.:.. |||..|...||..:|..:||.|.:.  
Zfish   288 AREYHGDAGNAFSYSKQYNHDGRAFSTYDRDHDRYAAGNCARYYGAGWWFDSCLAANLNGRFY-- 350

  Fly   255 DEGQYFQ-WKGIVWHSW------RT-ESYSYKVMQMMVRPK 287
             .|:|.. ..||.|.:|      || |.||:|.::|..||:
Zfish   351 -HGRYSGITDGIYWGTWYILTEYRTGERYSFKSVEMKTRPR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/260 (32%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 79/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.