DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fcn2l

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:197 Identity:74/197 - (37%)
Similarity:109/197 - (55%) Gaps:4/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAI 155
            |.:...|::|.:|.||....|.||.|..||....::|||.|..||:|||....:|::|.|.||.:
 Frog   107 YIIYPDGVQPMKVLCDMHTDGGGWIVFQRRWDGSVDFFRDWKSYKSGFGSRLNEFWLGNDNLHKL 171

  Fly   156 TKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSM-IHNRNQNFSTFD 219
            |.|...||.:.|:|||....:|.|:...|..|::.:.:.......|:..|:| :|| ...|||.|
 Frog   172 TSSGTWELRVDLQDFENAKHFAKYESFRILGESEKFKLLIGAMKGGNIEDAMKVHN-TMPFSTKD 235

  Fly   220 RDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMV 284
            :|||...::||:.|.|.||:..|.:|||.|:|:.|......:  ||.|:..|..:||||..:|.:
 Frog   236 QDNDILPEHCADRYKGGWWYNGCHHSNLNGLYLLGSHSNTAE--GINWYGGRGHNYSYKRSEMKI 298

  Fly   285 RP 286
            ||
 Frog   299 RP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 74/197 (38%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 72/195 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.