DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angpt2a

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001265754.1 Gene:angpt2a / 101101687 ZFINID:ZDB-GENE-121101-1 Length:488 Species:Danio rerio


Alignment Length:308 Identity:89/308 - (28%)
Similarity:148/308 - (48%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SFYSTEAMDSESFQN---DTAIRNKPELKSLYKL---VLALLEENQSNASTEN--IQKSSSDLNT 70
            ||......|.|..:|   :|....|.|||.|.::   |:..:|:..|:.|::|  :::...:|..
Zfish   181 SFLEKGIEDMEGKRNTELETLKEEKEELKKLVEMLAKVIKEMEQQVSSTSSDNTAMKQQQQELTN 245

  Fly    71 T-----------------GLSGRYPSQ---CPTY----PPAHGIYTVQVLGLK-PFQVSCDAEIA 110
            |                 .:....|.|   |...    ....|:|::.:.|.| .|:..||....
Zfish   246 TVNNLIQTISVTRQGSNSAMMQDNPDQLIDCAVVFKQGNKKSGVYSLTIPGTKQQFKAYCDMGTD 310

  Fly   111 GTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTR 175
            |.||||:.:|.:..::|.::|..|..|||.:.|:.::|.:.:..:|:.:.|.|.|.|.|:||.|.
Zfish   311 GGGWTVIQKRFNGLVDFHQTWKNYTMGFGDISGEHWLGNEIISKLTQEKQHTLRIDLMDWEGNTA 375

  Fly   176 YAHYDEIFIESENKFYAMTKLGEFTGDAG-DSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWH 239
            ::.|.:..::.|.:.|.:: |..::|.|| .|.:.....:||..|.|||.....|::...|.||.
Zfish   376 FSKYSQFSLDGEKQNYRIS-LNGYSGTAGRTSSMGQTGGDFSAKDLDNDKCVCKCSQMLSGGWWF 439

  Fly   240 LNCTYSNLFGIYVKGDEGQYF-QWKGIVWHSWRTESYSYKVMQMMVRP 286
            ..|..|||.|||.:  :||.. ::.||.|:.|:..:||.|...||:||
Zfish   440 DACGPSNLNGIYYQ--QGQNTNRFNGIKWYYWKGSAYSLKATTMMIRP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 71/221 (32%)
angpt2aNP_001265754.1 FReD 275..485 CDD:238040 67/212 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.