DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and mfap4.10

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001314993.1 Gene:mfap4.10 / 100537823 ZFINID:ZDB-GENE-121214-100 Length:245 Species:Danio rerio


Alignment Length:226 Identity:77/226 - (34%)
Similarity:122/226 - (53%) Gaps:19/226 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SQCPTYPP------------AHGIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMARRTSNKLN 126
            |.|..:.|            ..|||::...|..|..|.|.....|.     ||||..||...::|
Zfish    19 SVCDGFKPFDCSEIYKSGQTGSGIYSIYPAGNTPVWVYCQMISEGKVQDNGGWTVFQRRLDGRIN 83

  Fly   127 FFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFY 191
            |::.|.|||.|||..:|::::||:.|:.:|:.:.:.|.:.||||.|:..:|.|....:.||.:.|
Zfish    84 FYQPWEEYKRGFGTTEGEYWLGLENLYQLTRHKNYMLRVDLEDFTGRRGFAQYSSFSVGSEAEGY 148

  Fly   192 AMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDE 256
            .:...|...|.|||||.|:....|||:|:|.|...:|||...:||:|:.||.|:|..|:|:.|::
Zfish   149 KLQISGFTDGGAGDSMTHHNGMKFSTYDKDQDIDSRNCARLRLGAFWYRNCYYANPNGVYIGGED 213

  Fly   257 GQYFQWKGIVWHSWRTE-SYSYKVMQMMVRP 286
            ...:. .|.||:||:.. ::..|::.|.::|
Zfish   214 STIYA-IGDVWYSWKNNANFGMKLITMKIKP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 77/226 (34%)
mfap4.10NP_001314993.1 FReD 26..244 CDD:238040 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.