DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and tnxba

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_021322558.1 Gene:tnxba / 100536295 ZFINID:ZDB-GENE-070103-5 Length:2285 Species:Danio rerio


Alignment Length:237 Identity:86/237 - (36%)
Similarity:117/237 - (49%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSDLNTTGLSGRYPSQCPTYPPAHGIYTVQVLGLK---------------PFQVSCDAEIAGTGW 114
            |||..|..|...||:.|.         .||:.|:|               |.:|.||.|..|..|
Zfish  2050 SSDFTTAQLPHPYPTDCS---------EVQINGMKESGEAEIYPEGKNGEPVRVYCDMETDGGAW 2105

  Fly   115 TVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHY 179
            ||..||.....:|||||.:|..|||.|.|:|::|.|.||.:|..:...|.|.|.. ...|.:|.|
Zfish  2106 TVFQRRMDGSTDFFRSWRDYSKGFGLLSGEFWLGNDVLHTLTSLKAMSLRIDLRS-GNDTAFAQY 2169

  Fly   180 DEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTY 244
            ....|.||...||: .|..::|.|||||.:::.:.|||.|:|.|....:||:.|:|.||:.||..
Zfish  2170 INFNISSEANHYAI-DLSGYSGTAGDSMKYHKGRPFSTKDKDPDTLSIHCAKAYMGGWWYKNCYK 2233

  Fly   245 SNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            :||.|:|     ..|...||:||..|:.:..|....:|.:||
Zfish  2234 ANLNGLY-----ASYSDNKGVVWIDWKGKDASLPFTEMKLRP 2270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 81/226 (36%)
tnxbaXP_021322558.1 COG3942 596..>913 CDD:332523
EGF_2 1380..1406 CDD:285248
fn3 1792..1870 CDD:306538
fn3 1880..1952 CDD:306538
fn3 1976..2037 CDD:306538
FReD 2061..2270 CDD:238040 79/224 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.