DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC100496945

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_002935082.1 Gene:LOC100496945 / 100496945 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:200 Identity:79/200 - (39%)
Similarity:109/200 - (54%) Gaps:6/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLH 153
            |.|.:...|.:|..|.||.:..|.||.|..|.....::|||.|..||.|||....:|::|.|.:|
 Frog   112 GWYKIYPDGERPLTVLCDMDTDGGGWIVFQRTWDGSVDFFRDWDSYKKGFGSQLSEFWLGNDNIH 176

  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFST 217
            .:|.|..::|.|...|||.|..:|.||......|...|.:. ||.:: |.||||:.|:||..|||
 Frog   177 TLTSSGTYQLRIDFTDFENQNSFAAYDSFATLGEKDHYQLI-LGAYSGGTAGDSLNHHRNCPFST 240

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
              :|||....||||.:.|.||:.:|..:||.|:|::|....  ...||.|.:.:..:|||||.:|
 Frog   241 --KDNDLHGNNCAETFKGGWWYGSCHDANLNGLYLRGKHSN--DGLGINWETGKGNNYSYKVTEM 301

  Fly   283 MVRPK 287
            ..|||
 Frog   302 KFRPK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 77/198 (39%)
LOC100496945XP_002935082.1 Collagen 41..91 CDD:189968
FReD 98..306 CDD:238040 77/198 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.