DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC100496379

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_031746585.1 Gene:LOC100496379 / 100496379 -ID:- Length:490 Species:Xenopus tropicalis


Alignment Length:253 Identity:88/253 - (34%)
Similarity:131/253 - (51%) Gaps:15/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LALLEENQSNASTENIQKSSSDLNTTGLSGR----YPS-----QCPTYPPA-HGIYTVQVLGLKP 100
            ||:|.|.........::..:......|..|.    ||:     :..||... .|.||:...|.||
 Frog   240 LAILRECTGAPGPPGLKGDTGPAGHQGEKGESRVWYPAVKNCMELRTYGVLFSGWYTIYPDGNKP 304

  Fly   101 FQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYI 165
            ..|.||....|.||.|..:|....::|:|.|..|:.|||....:|::|.:.:|.:|.|...:|.|
 Frog   305 LNVLCDMHTDGGGWIVFQKRMDGSVDFYRDWGSYRQGFGSQLSEFWLGNENIHRLTSSGNIQLRI 369

  Fly   166 HLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFSTFDRDND-GWHKN 228
            .||||:....||.|.:..:|.|::.|.: :||.|| |.||||:..:.|:.|::.|.|.| ..:.|
 Frog   370 DLEDFDNNRTYATYSQFRLEPESQKYTL-RLGAFTGGTAGDSLSSHNNKAFASKDADYDESVNSN 433

  Fly   229 CAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            |||:|.||||::.|..:.|.|.|::|..||  .:.||.|.::|..:||.|..:|..||
 Frog   434 CAEKYKGAWWYVKCYDACLNGEYLRGPLGQ--NYGGIAWKTFRGYNYSLKKSEMKFRP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 82/223 (37%)
LOC100496379XP_031746585.1 Collagen 91..144 CDD:396114
Collagen <213..270 CDD:396114 5/29 (17%)
FReD 276..490 CDD:238040 81/217 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.