DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC100493748

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_002945140.2 Gene:LOC100493748 / 100493748 -ID:- Length:227 Species:Xenopus tropicalis


Alignment Length:199 Identity:73/199 - (36%)
Similarity:102/199 - (51%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLH 153
            |.||:...|:.|.||.||.:..|.||.|..||....::|:..|..||.|||....:|::|.|.|.
 Frog    33 GWYTIYPDGMAPLQVLCDMDTDGGGWIVFQRRYDGSVDFYLGWDSYKRGFGSRLTEFWLGNDNLS 97

  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEF-TGDAGDSMIHNRNQNFST 217
            ..|.|...|:.:.|.||:....||.|....:..|:..|.:. :|.: .|||||||.::....|:|
 Frog    98 NFTSSGTWEMRVDLRDFDNIQHYAKYSSFRVLPESDSYTLI-IGPYVAGDAGDSMSYSNYSKFTT 161

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
            .|||||.:...||:...||||:..|..:||.|.|   ...|.:....|.|.|..: .||:|..:|
 Frog   162 KDRDNDMYEGKCADIDRGAWWYKICYNANLNGFY---HLAQNYNIDSICWLSLGS-YYSFKFTEM 222

  Fly   283 MVRP 286
            .:||
 Frog   223 KMRP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 73/199 (37%)
LOC100493748XP_002945140.2 FReD 19..227 CDD:238040 73/199 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.