DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC100334800

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:227 Identity:79/227 - (34%)
Similarity:121/227 - (53%) Gaps:22/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SDLNTTG-LSGRYPSQCPTYPPAHGIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMARRTSNK 124
            |||:.:| .|.|          .|.:|    :...|..|.|.....|.     ||||:.:|....
Zfish    32 SDLHRSGERSSR----------THTVY----IDDSPINVDCHMISEGREDEHGGWTVIQKRMDGS 82

  Fly   125 LNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENK 189
            |||:|.|.|||.|||..:|:.::||:.:|.||:::.:.|.:.:|||.|:...|||....::.|..
Zfish    83 LNFYRPWKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAHYSSFSVDCEED 147

  Fly   190 FYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKG 254
            .|.:...|...|.||||:..:.||.|||||:|.|.:.||||.|::|.:|:..|.::|..|:|:.|
Zfish   148 GYKLHVSGFRDGGAGDSLSSHNNQKFSTFDKDQDDYKKNCAREFLGGFWYKKCHHANPNGVYLWG 212

  Fly   255 DEGQYFQWKGIVWHSWRTESY-SYKVMQMMVR 285
            .:..::. .|:.|.||....| |.|.:.|.::
Zfish   213 HDRTHYA-IGVCWWSWDHNYYNSLKYISMKIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 74/216 (34%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.