DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angptl1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001123408.1 Gene:angptl1 / 100170184 XenbaseID:XB-GENE-482123 Length:487 Species:Xenopus tropicalis


Alignment Length:298 Identity:95/298 - (31%)
Similarity:139/298 - (46%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VLALLEENQSNASTENIQKSSSDL-------------NTTGLSG----------------RYPSQ 80
            |:|||||......:......|..|             .|.||.|                |.|.|
 Frog   189 VIALLEEQCMKVFSRRDSPGSPPLVQVVPQHYPQIHQYTPGLGGGNEIQRDTGYPRTRDSRQPPQ 253

  Fly    81 CPT-----YPPA---------------------HGIYTVQVLGL-KPFQVSCDAEIAGTGWTVMA 118
            .||     .||.                     .|||.::.... .|.|:.|:..:...||.|:.
 Frog   254 APTSSPFRIPPVTIIDEGPFRDCQHAKESGFSNSGIYLIKPDNANSPMQLWCENSLDPGGWAVIQ 318

  Fly   119 RRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIF 183
            ||.....||||:|..||.|||.:|.::::||:.::.:|....:.|.|.|||:..:..||.|....
 Frog   319 RRIDGSANFFRNWETYKKGFGNIDAEYWLGLENIYQLTNQDNYRLLIELEDWSNKKVYAEYSSFR 383

  Fly   184 IESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLF 248
            :|||::||.: :||.:.|:||||||.:..:.|:|.|||.|.:..|||..:.|.||:..|.::||.
 Frog   384 LESESEFYKL-RLGTYQGNAGDSMIWHNGKQFTTLDRDKDMYSGNCAHFHKGGWWYNACAHANLN 447

  Fly   249 GIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            |::.:|...:.....||.|..:|..|||.|.:||::||
 Frog   448 GVWYRGGHYRSKHQDGIYWAEYRGGSYSLKAVQMLIRP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/238 (35%)
angptl1NP_001123408.1 FReD 271..486 CDD:238040 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.