DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fibcd1a

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_005166963.1 Gene:fibcd1a / 100151577 ZFINID:ZDB-GENE-081105-148 Length:464 Species:Danio rerio


Alignment Length:231 Identity:88/231 - (38%)
Similarity:126/231 - (54%) Gaps:23/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KSSSDLNTTGL--SGRYPSQCPTYPPAHGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKL 125
            :..||:..:|.  .|.| |..||:.||            .|||.||....|.||||:.||....:
Zfish   244 RDCSDIYASGQREDGIY-SVFPTHYPA------------GFQVFCDMTTDGGGWTVIQRREDGSV 295

  Fly   126 NFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDE----IF-IE 185
            ||||.|..|:.|||::.|:.::|:.::||:|....:||.|.|||||..|.:|.|..    :| ::
Zfish   296 NFFRDWEAYREGFGKITGEHWLGMKRIHALTIQANYELRIDLEDFENSTSFAQYGSFGVGLFSVD 360

  Fly   186 SENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGI 250
            .:...|.:: :.:::|.||||::.:....|:|.|:|||....|||..|.||||:.||..|||.|.
Zfish   361 PDEDGYPLS-IADYSGTAGDSLLKHNGMKFTTKDKDNDHSENNCASFYHGAWWYRNCHTSNLNGQ 424

  Fly   251 YVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            |::|....|..  ||.|.||....||.|..:|.:||
Zfish   425 YLRGQHTSYAD--GIEWSSWTGWQYSLKFTEMKIRP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 84/216 (39%)
fibcd1aXP_005166963.1 FReD 243..458 CDD:238040 86/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.