DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and mfap4.2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001103320.1 Gene:mfap4.2 / 100126122 ZFINID:ZDB-GENE-071004-112 Length:242 Species:Danio rerio


Alignment Length:229 Identity:75/229 - (32%)
Similarity:118/229 - (51%) Gaps:18/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SGRYPSQCPTYP-----------PAHGIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMARRTS 122
            |....|.|.:.|           ...|:||:...|..|..|.|.....|.     ||||:.||..
Zfish    12 SAALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYCQMISDGKDEENGGWTVIQRRMD 76

  Fly   123 NKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESE 187
            ..:||:|...:||.|||.::|::::||:.|:.:|:.:...|.:.||||||:..:|.|....:..|
Zfish    77 GSVNFYRPGRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCE 141

  Fly   188 NKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYV 252
            .:.|.:...|...|.||||...:....|||||:|.|.:.||||:|::||:|:..|..:|..|:|:
Zfish   142 CEGYKLQVSGFTDGGAGDSASTHNGMKFSTFDKDQDTYEKNCAKEFLGAFWYSACHNANPNGVYL 206

  Fly   253 KGDEGQYFQWKGIVWHSWR-TESYSYKVMQMMVR 285
             ..||......|:.|:||: ..:.|.|.:.:.::
Zfish   207 -WHEGSTHNAIGVSWYSWKGNNAVSMKTISIKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 74/227 (33%)
mfap4.2NP_001103320.1 FReD 23..239 CDD:238040 72/216 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.