DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC100007488

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:202 Identity:69/202 - (34%)
Similarity:116/202 - (57%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIG 148
            |||::...|..|..|.|.....|.     ||||:.||....:||:|.|.:||.|||:::|::::|
Zfish    42 GIYSIYPAGDFPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRPWRDYKRGFGKVEGEYWLG 106

  Fly   149 LDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQ 213
            |:.|:.:|:.:...|.:.||||||:..:|.|....:..|.:.|.:...|...|.|||.:..:.:.
Zfish   107 LENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDCLSGHNDL 171

  Fly   214 NFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYK 278
            .|||||:|.|...|:||:||:|.:|:.:|..:|..|:|:.|::..::. .|:.|.:|:..:.|.|
Zfish   172 KFSTFDKDQDTHEKSCAKEYLGGFWYGSCHNTNPNGVYLWGEDPTHYA-IGVCWSTWKNYAVSMK 235

  Fly   279 VMQMMVR 285
            ...|.::
Zfish   236 TFSMKIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 69/202 (34%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 69/202 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.