DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and mfap4.3

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_001339903.1 Gene:mfap4.3 / 100007474 ZFINID:ZDB-GENE-110408-14 Length:242 Species:Danio rerio


Alignment Length:240 Identity:77/240 - (32%)
Similarity:122/240 - (50%) Gaps:34/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 TGLSGRYPSQCPTYP-----------PAHGIYTVQVLGLKPFQVSCDAEIAGT-----GWTVMAR 119
            |.||....|.|.:.|           ...|:||:...|..|..|.|.....|.     ||||:.|
Zfish     9 TLLSAALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYCQMLSDGKDEENGGWTVIQR 73

  Fly   120 RTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFI 184
            |....:||:|.|.:||.|||.::|::::||:.|:.:|:.:...|.:.||||||:..:|.|....:
Zfish    74 RMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSV 138

  Fly   185 ESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFG 249
            ..|.:.|.:...|...|.||||:..:....|||||:|.|.:.||||:|::|.:|:.:|..:|...
Zfish   139 GCECEGYKLQVSGFTDGGAGDSLSPHNGMKFSTFDKDQDTYEKNCAKEFLGGFWYSSCHNTNPNA 203

  Fly   250 IYVKGDEGQYFQWK--------GIVWHSWR-TESYSYKVMQMMVR 285
            :|:         |:        |:.|:||: |.:.|.|.:.|.::
Zfish   204 VYL---------WEEDVTHHAIGVSWYSWKGTHAVSMKTISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 74/235 (31%)
mfap4.3XP_001339903.1 FReD 23..239 CDD:238040 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.