DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fgl2b

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:301 Identity:99/301 - (32%)
Similarity:150/301 - (49%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 STEAMDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGR--YPS 79
            :.|...|.:..::...|.|.|.| ::...|.    |.:..||.:.|.|:|...|.....|  .|:
Zfish  1159 TAEGFKSHAVSDEVTEREKAENK-IHSTCLG----NCNTTSTPHSQPSTSQTRTPLAPEREKRPA 1218

  Fly    80 Q-CPTY---PPAHGIYTVQVLGLKP----FQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKN 136
            | |..|   ...:|:|.|..   :|    |.|.||...:|.|||::..|.....:|.|:|.||||
Zfish  1219 QDCADYITKSRRNGVYRVTP---RPKNTTFPVFCDMASSGGGWTLIQHRFDGSTSFNRTWDEYKN 1280

  Fly   137 GFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTG 201
            |||:|.|:|::|.||:|.:||::...|.|.:|||||...||.||..:|.:|::.|.:: :..::|
Zfish  1281 GFGKLIGEFWLGNDKIHLLTKAKNMSLRIEIEDFEGIREYAQYDHFYIANESQQYRLS-IDGYSG 1344

  Fly   202 DAGDSMIHNRNQN-----FSTFDRDNDGWHK-NCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYF 260
            .||::|..::..|     |:|.|||||.:.. ||...|...||...|..:||        .|:|:
Zfish  1345 TAGNAMQFSKKYNHDQKFFTTPDRDNDQYPSGNCGAYYSSGWWFDACMSANL--------NGKYY 1401

  Fly   261 QWK------GIVWHSWR---------TESYSYKVMQMMVRP 286
            |.|      ||.|.:|.         .|..|::.::||:||
Zfish  1402 QSKYKGVRNGIFWGTWHNITMEYYPTNERQSFRTVRMMIRP 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 85/242 (35%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.