DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk14 and ASIC3

DIOPT Version :9

Sequence 1:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_064717.1 Gene:ASIC3 / 9311 HGNCID:101 Length:549 Species:Homo sapiens


Alignment Length:526 Identity:118/526 - (22%)
Similarity:197/526 - (37%) Gaps:130/526 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YISRSHIHGLYLLFLPSMRRRMRVLWALALICA-CTVLFHVSYLLGDRYHNKQFQTIVAHAHASI 108
            :.|...:|||..:|.|......|.:||.|::.: .|.|:.|:..:  ||: ::|....|......
Human    20 FASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERV--RYY-REFHHQTALDERES 81

  Fly   109 HHIAFPVVIICNKNRLNWSRLPEI------KSLYNITPSQDELFDRIL---TAYDGF----SFHK 160
            |.:.||.|.:||.|.|..|||...      .:|..:.|::...|.|.|   .|..||    :|..
Human    82 HRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMPSPTFDM 146

  Fly   161 FNAFDSLLGESLDELNHLNFTEIVIQMSWRCDEILRDCHWQTASRDCCKLFRPRRLP-----LGY 220
            ...: :..|.|||::                   |.||.::  .:.|    .|....     :|.
Human   147 AQLY-ARAGHSLDDM-------------------LLDCRFR--GQPC----GPENFTTIFTRMGK 185

  Fly   221 CLAFNE----LEKRRGTETGINTGLLLRLLLREGQHAPGNSGLKGFWLTVVESSVWFGFPIEVVP 281
            |..||.    .|....|..|:..||.:.|.:::.::.|       .|....|:....|..:::  
Human   186 CYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLP-------VWRDNEETPFEVGIRVQI-- 241

  Fly   282 HS--------RTNVAVTAVYHYF---DESTLS-LPSSWRHCVM-----DYE-EESEHFRT---LE 325
            ||        :..:.|:..|..|   .:..|| ||..|..|..     :|| |.|:...:   ..
Human   242 HSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLGSPSPSP 306

  Fly   326 GQKYMLENCQAECQQRYLLRYCNCTVDLFYPPSNYPACRLKDLPCLAAHNHLLQNFEQPGEHPYV 390
            ...|.|..|:..|:.||:.|.|.|.  :.|.|.:.|.|..:.....|              ||.:
Human   307 SPPYTLMGCRLACETRYVARKCGCR--MVYMPGDVPVCSPQQYKNCA--------------HPAI 355

  Fly   391 H---REESGLVCECLHNCKSLTLLTDM---------------RK-SVQQPWLQPNSSAIESMWLN 436
            .   |::|   |.|.:.|.|.....::               || :..:.::..|..|     |:
Human   356 DAMLRKDS---CACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLA-----LD 412

  Fly   437 VYFKKPSMLVYKTNLIYTWVDLIVSFGGICQLCLGCSIISLIEFVFFALY----KVPQLYWER-F 496
            ::|:..:....:....|...:|:...||...|.:|.|:::::|.:.:...    ||...:|.| .
Human   413 IFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQH 477

  Fly   497 SNEHRS 502
            |..|.|
Human   478 SQRHSS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk14NP_609017.2 ASC 45..483 CDD:279230 111/500 (22%)
ASIC3NP_064717.1 ASC 20..534 CDD:295594 118/526 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..307 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.