DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk14 and ASIC5

DIOPT Version :9

Sequence 1:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:531 Identity:103/531 - (19%)
Similarity:177/531 - (33%) Gaps:140/531 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DSYISRSHIHGLYLLFLPSMRRRMRVLWALALICACTVLFHVSYLLGDRYHNKQFQTIVAHAHAS 107
            |..||.| .||::.: :.:..:..||||.:.::.:.:::....|:....|......|.:...:  
Human    40 DFAISTS-FHGIHNI-VQNRSKIRRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSIEVQY-- 100

  Fly   108 IHHIAFPVVIICNKNRLN-------------WSRLPEIKSLYNITPSQD---ELFDRILTAYDGF 156
            :..:.||.|..||.||..             |..:.::..|..||.:..   |..| ...::..|
Human   101 VEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATD-FAASHQNF 164

  Fly   157 SFHKF---NAFDSLLGESLDELNHLNFTEIVIQMSWRCDEILRDCHW---QTASRDCCKLFRPRR 215
            |..:|   ..|            :||            :..|.||.:   ..:.:|...:|    
Human   165 SIVEFIRNKGF------------YLN------------NSTLLDCEFFGKPCSPKDFAHVF---- 201

  Fly   216 LPLGYCLAFNELEKRRGTETGINTGLLLRLLLREGQHAPGNSGLKGFWLTVVESSVWF------- 273
            ...|.|..||..|..:.......:|..|.||....|.|..::...||    |::.:.|       
Human   202 TEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGF----VDAGIIFVIHSPKK 262

  Fly   274 -------GFPIEVVPHSRTNVAVTAVYHYFDESTLSLPSSWRHCVMDYEEESEHFRTLEGQKYML 331
                   |....|..|:|..:......|.      ..|  |..|       :.:.:......|..
Human   263 VPQFDGLGLLSPVGMHARVTIRQVKTVHQ------EYP--WGEC-------NPNIKLQNFSSYST 312

  Fly   332 ENCQAECQQRYLLRYCNCTVDLFYPP-------SNYPAC--------RLKDLPCLAAHNH----L 377
            ..|..||:.:::.:.|.| |....|.       ..|.:|        ..|||..:..||.    .
Human   313 SGCLKECKAQHIKKQCGC-VPFLLPGYGIECDLQKYFSCVSPVLDHIEFKDLCTVGTHNSSCPVS 376

  Fly   378 LQNFEQPGEHPYVHREESGLVCECLHNCKSLTLLTDMRKSVQQ--PWLQPNSSAIESMWLNVYFK 440
            .:..|.|....|          ....:.|:|..|:   |.:.|  .:::.|...||..:.::.:|
Human   377 CEEIEYPATISY----------SSFPSQKALKYLS---KKLNQSRKYIRENLVKIEINYSDLNYK 428

  Fly   441 KPSMLVYKTNLIYTWVDLIVSFGGICQLCLGCSIISLIEFV-----------FFALYKVPQL-YW 493
                 :.:.....:..:|:...||...|..|.|:|::||.:           .|.|.|:.:: .|
Human   429 -----ITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQW 488

  Fly   494 ERFSNEHRSNK 504
            ......|..||
Human   489 TPPPQNHLGNK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk14NP_609017.2 ASC 45..483 CDD:279230 95/505 (19%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 95/495 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.