DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk14 and ppk27

DIOPT Version :9

Sequence 1:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:492 Identity:112/492 - (22%)
Similarity:190/492 - (38%) Gaps:104/492 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEIQRAWTLLIDSYISRSHIHGLYLLFLPSMRRRMRVLWAL----ALICACTVLFH--VSYLLGD 90
            |.|..|:...:..|..::.::|..||:....||..|:.|.|    .::.|...:|.  :.:|   
  Fly     2 SRIVTAFNKTVVEYFRKTSLNGFGLLYFIRKRRIQRIFWFLFISFGILFASYAVFSMVLEFL--- 63

  Fly    91 RYHNKQFQTIVAHAHASI--HHIAFPVVIICNKNRLNWSRLPEIKSLYNITPSQDELFD------ 147
                 .:.||...:...:  ..|.||.:.||:..:.::..:  :.|.:::..||::..|      
  Fly    64 -----SYSTIADLSELKVLEDEIHFPELKICSGYKFSYRNM--LASAHDLVSSQNKSLDYWLNKL 121

  Fly   148 RILTAYDGFSFHKFNAFDSLLGESLDELNHL----NFTEIVIQMSWRCDEILRDCHWQTASRDCC 208
            .:|:.|       |:|. |:..|::|:||.|    |.:..::.::..|:.::..|.......:|.
  Fly   122 SLLSGY-------FDAL-SVKAENVDDLNSLLDIKNISSFLLALTPACESLILKCKLNNIPANCL 178

  Fly   209 KLFRPRRLPLGYCLAFNELEKRRGTETGINTGLLLRLLLREGQ--HAPGNSGLKGFWLTVVESSV 271
            |||..:....|.|...     |....||     .|.|.:...|  ..|.|..|.||.|.|..   
  Fly   179 KLFTLKAYNDGNCCVL-----RNSNLTG-----ELTLFMDSSQIDEYPLNGNLPGFSLHVPS--- 230

  Fly   272 WFGFPIEVVPHSRTNVAVTAVYHYFDESTLSLPSSWRHCVMDYEEESEHFRTLEGQKYMLENCQA 336
            |.| .:.:.|.....|.:..:....:..........|.|....|.||.            |.|..
  Fly   231 WQG-RVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESR------------EKCLH 282

  Fly   337 ECQQRYLLRYCNCTVDLFYP----PSNYPACRLKDLPCLAAHNHLLQNFEQPGEHPYVHREESGL 397
            ||:.:..|..|.|..   ||    ...:..|.|:::.||    .|::....|.:.|         
  Fly   283 ECRIKATLINCQCVP---YPFEFRTQKFGYCTLENIRCL----QLVERNWSPAQCP--------- 331

  Fly   398 VCECLHNCKSLTLLTDMRKSV---QQPWLQPNSSAIESMWLNVYFKKPSMLVYKTNLIYTWVDLI 459
              :||..|..  |...:.|.:   ..||...         ||..||.|....||||::|.|..::
  Fly   332 --QCLPLCNQ--LFYRLNKQILGHLHPWRSE---------LNFKFKTPHRQRYKTNILYHWYQML 383

  Fly   460 VSFGGICQLCLGCSIISLIEFVFFALYKVPQLYWERF 496
            .:.||:..:|:|||.||..|.::|.::::    |..:
  Fly   384 SNVGGVLGICIGCSFISGFELIYFLVFRL----WTNY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk14NP_609017.2 ASC 45..483 CDD:279230 107/464 (23%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 107/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.