DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk14 and egas-4

DIOPT Version :9

Sequence 1:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:282 Identity:61/282 - (21%)
Similarity:108/282 - (38%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LGYCLAFNELE---KRRGTETGINTGLLLRLLLREGQHAP--GNSGLKGFWLTVVESSVWFGFPI 277
            ||.|..||.:.   |.....:|...||.:::.:::.::.|  ..:|:..|..|..|:.......|
 Worm   609 LGNCFTFNHMNSSFKYEARSSGYPGGLEMQMNVKQDEYLPWTETAGVMVFTSTKEEAVTSESVRI 673

  Fly   278 EVVPHSRTNVAVTAVYHYFDESTLSLPSSWRHCVMDYEEESEHFRTLEGQKYMLENCQAECQQRY 342
            ...||..:.:|:..|.:|      .|...:..|:....|...::  .:|. |..:.|...|.|..
 Worm   674 NTAPHFESRIAINRVDYY------RLGGRYGVCINSVSEVKSYY--YDGD-YTTDGCLRSCYQDV 729

  Fly   343 LLRYCNCTVDLFYP-PSNYPACRLKDLPCLAAHNHLLQNFEQPGEHPYVHREESGLVCECLHNC- 405
            :...|.| :|..|| |::..:|.:....|:   :.|:.:...|...|         .|.|...| 
 Worm   730 VNGDCGC-MDPRYPMPNDGISCSISQKTCI---DELVDSRGDPSTWP---------ECTCPLPCS 781

  Fly   406 -----KSLTLLTDMRKSVQQPWLQPNSSA-----IESMWLNVYFKKPSMLVYKTNLIYTWVDLIV 460
                 ..|:.|..:.|.|.......|.:|     ::|:.|.:...|...::|...........:.
 Worm   782 QTVYTSKLSRLPYVNKIVDCEEAYTNKTACYETFLDSVILRISLPKLDYMIYSETPAMDLTKFMS 846

  Fly   461 SFGGICQLCLGCSIISLIEFVF 482
            ..|||..:.:|.||:|.:|..|
 Worm   847 YLGGILSILIGVSIVSFVELFF 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk14NP_609017.2 ASC 45..483 CDD:279230 61/282 (22%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 60/281 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.