DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk14 and egas-2

DIOPT Version :9

Sequence 1:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_507640.2 Gene:egas-2 / 190561 WormBaseID:WBGene00013487 Length:919 Species:Caenorhabditis elegans


Alignment Length:292 Identity:57/292 - (19%)
Similarity:106/292 - (36%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LGYCLAFNELEKRRGTETGINTGLLLRLLLREGQHAPGNSGLKGFWLT-VVESSVWF---GFPIE 278
            ||.|..||..::        |...|:|   |.|:|    .|::.|..| ..|.:.|:   |..:.
 Worm   649 LGNCFTFNHQDQ--------NFTYLMR---RPGRH----GGIQAFMKTRQDEYAPWYDTAGMLVF 698

  Fly   279 VVPHSRTNVAVTAVYHY----FDESTLS--------LPSSWRHCVMDYEEESEHFRTLEGQKYML 331
            :  |:|.:...:....|    ..:||::        |...:..||....|...::..   ..|..
 Worm   699 I--HNREDYVFSESVRYNAQPNAQSTINIFMTRYTRLGGRYGKCVKKPSEVKNYYYP---GAYTT 758

  Fly   332 ENCQAECQQRYLLRYCNCTVDLFYPPS-NYPACRLKDLPCLAAHNHLLQNFEQPGEHPYVHREES 395
            :.|...|.|..:.:.|.| :|..||.: |..:|:|.:..|:.      :..:..|:      ..:
 Worm   759 DGCLRTCYQDRMQQECQC-MDPRYPKAPNATSCQLSERSCVT------EASDAAGD------PST 810

  Fly   396 GLVCECLHNCKSLTLLTDMRKS--VQQPWLQPNSS--------AIESMWLNVYFKKPSMLVYKTN 450
            ...|.|...|.:........|:  |..|.....||        .::.:.:::...|....:|...
 Worm   811 WSSCVCPLPCSNQEYSVTWSKANFVNMPITCEKSSDVATCQANYVDQLMVSIVLPKLDFQIYAET 875

  Fly   451 LIYTWVDLIVSFGGICQLCLGCSIISLIEFVF 482
            ....:...:...||...:.:|.::::.||.||
 Worm   876 PAMDFNKFLSQLGGQLGVLMGINLVTFIEVVF 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk14NP_609017.2 ASC 45..483 CDD:279230 57/292 (20%)
egas-2NP_507640.2 ASC <650..908 CDD:279230 56/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.