DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and ASIC5

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:529 Identity:111/529 - (20%)
Similarity:182/529 - (34%) Gaps:163/529 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FGKRTTIHGLDRLLSAKASRWERFVWLCTF---VSAFLGAVYVCLILSARYNAAHFQTVVDSTRF 99
            |...|:.||:..::..: |:..|.:||...   ||.....:|:.|:     |...:.|.......
Human    41 FAISTSFHGIHNIVQNR-SKIRRVLWLVVVLGSVSLVTWQIYIRLL-----NYFTWPTTTSIEVQ 99

  Fly   100 PVYRIPFPVITICNRNRLNWQRLAEAK-----------SRFL------ANGSNSAQQELFELIVG 147
            .|.::.||.:|.||.||  :|..|.||           |:.|      ||.:.|.:...|.    
Human   100 YVEKMEFPAVTFCNLNR--FQTDAVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFA---- 158

  Fly   148 TYDDAYFGHFQSFERLRNQPTELLNYVNFSQVVDFMTWRCNELLAECLWRHHAYDCCEIFSKRRS 212
                |...:|...|.:||:..    |:|.|.::|                      ||.|.|..|
Human   159 ----ASHQNFSIVEFIRNKGF----YLNNSTLLD----------------------CEFFGKPCS 193

  Fly   213 ---------KNGLCWAFNSLETEEGRRMQLLDPMWPWRTGSAGPMSALSVRVLIQPAKHWPGHRE 268
                     :.|.|:.||..||.:.:|          :...:|...:|...|      :.....:
Human   194 PKDFAHVFTEYGNCFTFNHGETLQAKR----------KVSVSGRGLSLLFNV------NQEAFTD 242

  Fly   269 TNAMKGIDVMVTEPFVWHNN---PFFVAANTETTMEIEPVIYFYDNDTRGVRSDQRQCVFDD-EH 329
            ..|:..:|..:.  ||.|:.   |.|.....     :.||........|.|::..::..:.: ..
Human   243 NPALGFVDAGII--FVIHSPKKVPQFDGLGL-----LSPVGMHARVTIRQVKTVHQEYPWGECNP 300

  Fly   330 NSKDFKSLQGY-VYMIENCQSECHQEYLVRYCNCTMDLLFPPG--------QYRSC--------R 377
            |.|    ||.: .|....|..||..:::.:.|.|...||  ||        :|.||        .
Human   301 NIK----LQNFSSYSTSGCLKECKAQHIKKQCGCVPFLL--PGYGIECDLQKYFSCVSPVLDHIE 359

  Fly   378 AQDLLCLAEHND-------------LLIYSHNPGEKEFVRNQFQGMSCKCFRNCYSLNYISDVRP 429
            .:||..:..||.             .:.||..|.:|                   :|.|:|   .
Human   360 FKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQK-------------------ALKYLS---K 402

  Fly   430 AFLPPDVYANNSYVDLDVHFRFETIMVYRTSLVFGWVDLMVSFGGIAGLFLGCSLISGMELA--- 491
            .......|...:.|.:::::......:.:........:|:...||..|||.|.|||:.:|:.   
Human   403 KLNQSRKYIRENLVKIEINYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYL 467

  Fly   492 ----YFLCI 496
                |::||
Human   468 FTNFYWICI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 108/524 (21%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 108/517 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.