DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and ppk29

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:472 Identity:119/472 - (25%)
Similarity:188/472 - (39%) Gaps:117/472 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VWLCTFVSAFLG--AVYVCLILSARYNAAHFQTVVDSTRFPVYRIPFPVITICNRNRLNWQRLAE 124
            :|:  ||....|  .|.:.::|..||. ....|:..||.:..:...||.|.||           .
  Fly    23 LWI--FVIGISGWSTVSILVLLKTRYE-TDSTTIGVSTAYSRWINTFPSIGIC-----------L 73

  Fly   125 AKSRFLANGSNSAQQELFELIVGTYDDAYFGHFQSFERL-------------RNQPTELLNY-VN 175
            .|||.. |...:..:|.|:      :|..|    ||.|:             ..:||:..:| .|
  Fly    74 TKSRAF-NEFKAMMREYFQ------EDFAF----SFTRMIYEYAFLNPNNIFTKEPTKNTSYPYN 127

  Fly   176 FSQVVD-----FMTWRCNELLAECLWRHH-AYDCCEIFSKRRSKNGLCWAFNSL----ETEEGRR 230
            |: ::|     |.| .|.|...|..:|.. ..||.|||....::.|.|:..|:|    ..||   
  Fly   128 FN-ILDIRRKMFPT-NCTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDSIEE--- 187

  Fly   231 MQLLDPMWPWRTGSAGPMSALSVRVLIQPAKHWPGHRETNAMKGIDVMVTEPFVWHNNPFFVAAN 295
                   .|.|..|.....:|.:            :..::.|...::.|..|   .:.|||   |
  Fly   188 -------MPLRYSSLDNNRSLRL------------YMRSSVMYKYEMYVNSP---EDLPFF---N 227

  Fly   296 TET-TMEIEPVIYFYD----NDTRGVRSD---QRQCVFDDEHNSKDFKSLQGYVYMIENCQSECH 352
            :.| |:..:|..|.::    ::..||..:   ||:|.|..|      .|::|:.|....|.|...
  Fly   228 SLTYTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKFPSE------SSIEGFPYSFSACMSIIR 286

  Fly   353 QEYLVRYCNCTMDLLFPPGQYRSCRAQDLLCLAEHNDLLIYSHNPG----EKEFVRNQFQGMSCK 413
            .|:.::.|:|:   ||.|..    |.:.|.|..:|.|.||   ..|    .||:|     |.|..
  Fly   287 SEFEMKTCDCS---LFNPKD----RNESLYCGLQHADCLI---KEGFATRVKEYV-----GSSTV 336

  Fly   414 CFRNCYSLNYISDVRPAFLPPDVYANNSYVDLDVHFRFETIMVYRTSLVFGWVDLMVSFGGIAGL 478
            |..:|.. ..||.|........:|.||:.: .::.......:.|...:....:||:|..|.:|||
  Fly   337 CLPSCVE-QQISLVGVITENGTLYNNNTQI-TEIQIASPPTVRYERKVTQTKLDLIVGIGSVAGL 399

  Fly   479 FLGCSLISGME-LAYFL 494
            |.|.||::.:| ::||:
  Fly   400 FFGASLLNLLEIISYFI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 117/469 (25%)
ppk29NP_001097442.2 ASC 123..415 CDD:279230 88/344 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.