DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and ppk17

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:465 Identity:84/465 - (18%)
Similarity:151/465 - (32%) Gaps:145/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FQSFERLRNQPTELLNYVNFSQVVDFMTWR-CNE--LLAECLWR-------HHAYDCC------- 204
            ::.|.:|.|.|....:|.:.::.::..:.. |.|  ...|.|.|       |..|..|       
  Fly    36 YECFAKLYNPPISTHSYYSLNETIEMPSVTICREPPYKEEVLTRLSGGACPHPKYATCWMKYPFG 100

  Fly   205 -----EIFSKRRSKNGLCWAFNSLETEEGR------------RMQLLDPMWPWRTGSAGPMSALS 252
                 |.|......:|..:.|..|..::..            |...|.|    :..:.....|:.
  Fly   101 EISLDEFFENSTHDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTLRP----KESAKRVSKAVG 161

  Fly   253 VRVLIQPAKHWPGHRETNAMKGIDVMVTEPFVWH------NNPF--------------FVAANTE 297
            ..::::.:      ..|.::..:|   |....||      ...|              ||..|.|
  Fly   162 YSIMLEHS------MLTTSVSDVD---TGSVGWHVFIHDKKENFTEINMKGSGRVEYVFVGVNEE 217

  Fly   298 TTMEIEPVIYFYDNDTRGVRSDQRQCVFDDEHNSKDFKSLQGYVY--MIEN--CQSECHQEYLVR 358
              :||:....::.|    |::.:..|  .|:.|..|.|..:..::  :.:|  |......|....
  Fly   218 --IEIKLQTQYFSN----VQTREEAC--SDDENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASE 274

  Fly   359 YCNCTMDLLFPPGQYRSCRAQDLLCLAEHNDLLIYSHNPGEKEFVRNQFQGMSCKCFRNCYSLNY 423
            .||.::.:              ...::::.|  :|.:   |.:|        .|.|.:.|.|..|
  Fly   275 PCNDSLSM--------------RKLISDYKD--VYEN---EDDF--------DCDCVQPCQSRIY 312

  Fly   424 ISDV--RPAFLPPDVYANNSYVDLDVHFRFETIMVYRTSLV--------FGWVDLMVSFGGIAGL 478
            .:.:  |.||..|:.             |.:..:.|.|.|:        :.....:...||..|.
  Fly   313 TTFIQNRKAFNQPEP-------------RTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGF 364

  Fly   479 FLGCS---LISGME-LAYFLCIEVPAFGLDGLRRRWKARRQMDLGVTVPTPTLNFQQTTPSQLME 539
            .||.|   ||..:| :..|.|        .|..:|.:.:.|..|...    :.:.|..|..:.::
  Fly   365 LLGLSVLGLIGILEHMMLFFC--------GGFIKRMQQKEQAKLEAN----SEDGQSQTSDETID 417

  Fly   540 NYIMQLKAEK 549
            ..|...|.||
  Fly   418 VEIAYKKKEK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 72/407 (18%)
ppk17NP_001285988.1 ASC 11..358 CDD:295594 63/382 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.