DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and Asic2

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:505 Identity:124/505 - (24%)
Similarity:197/505 - (39%) Gaps:121/505 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RTTIHGLDRL----LSAKASRWERFVWLCTFVSAFLGAVYVCLILSARYN-AAHFQTVVDSTRFP 100
            ||.:|||..:    .:|..|...|.:|:..|.:: ||     |:||...| ..::.:....||  
  Rat    63 RTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTS-LG-----LLLSWSSNRLLYWLSFPSHTR-- 119

  Fly   101 VYR-----IPFPVITICNRNRLNWQRLAEAKSRF------LANGSNSAQQELFELIVGTYDD--- 151
            |:|     :|||.:|:||.|.|.:.||::....:      |...:.:|:..:.||:.|  |:   
  Rat   120 VHREWSRQLPFPAVTVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSELLRG--DEPRR 182

  Fly   152 AYFGHFQSFERLRNQPTELLNYVNFSQV-VDFMTWRCNELLAECLWRHHAYDCC--EIFSKRRSK 213
            .:|.....| ||...|.   ::...|.. :|.:..:..::|..|.:|.   :.|  ..||...:|
  Rat   183 QWFRKLADF-RLFLPPR---HFEGISAAFMDRLGHQLEDMLLSCKYRG---ELCGPHNFSSVFTK 240

  Fly   214 NGLCWAFNSLETEEGRRMQLLDPMWPWRTGSAGPMSALSVRVLIQPAKH---WPGHRETNAMKGI 275
            .|.|:.|||  .|:|:      |:.....|..|  :.|.:.:.||..::   |....||....|:
  Rat   241 YGKCYMFNS--GEDGK------PLLTTVKGGTG--NGLEIMLDIQQDEYLPIWGETEETTFEAGV 295

  Fly   276 DVMV---TEPFVWHNNPFFVAANTETTMEIEPVIYFYDNDTRG-VRSDQRQCVFDDEHNSKDFKS 336
            .|.:   :||.......|.||...:|.:..:.....|.....| .||.:.         ..||..
  Rat   296 KVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEM---------GLDFFP 351

  Fly   337 LQGYVYMIENCQSECHQEYLVRYCNCTM-----DLLF-PPGQYRSCRAQDLLCLAEHNDLLIYSH 395
                ||.|..|:.:|...|:|..|||.|     |..| .|.|::.|....|..|||.:       
  Rat   352 ----VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKD------- 405

  Fly   396 NPGEKEFVRNQFQGMSCKCFRNCYSLNYISDVRPAFLP--------------PDVYANNSYVDLD 446
                         ...|.|...|....|..::....:|              .:.|.:.:.:.||
  Rat   406 -------------SNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLD 457

  Fly   447 VHF---RFETI---MVYRTSLVFGWVDLMVSFGGIAGLFLGCSLISGMEL 490
            :.|   .:|||   ..|..:.:.|      ..||..|||:|.||::.:||
  Rat   458 IFFEALNYETIEQKKAYEVAALLG------DIGGQMGLFIGASLLTILEL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 124/505 (25%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 123/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6095
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8907
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.