DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and del-5

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:98 Identity:24/98 - (24%)
Similarity:47/98 - (47%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 EFVRNQFQGMSCKCFRNCYSLNY---ISDVRPAFLPPDVYANNSYVDLDVHFR-FETIMVYRTSL 461
            |:::..|     .|:.:|..:.|   .|.:|        ::::|.|   :.|. ..||.:.:.:.
 Worm   257 EYLQYDF-----PCYPSCSEIKYQVSKSKLR--------HSSDSVV---ITFSVLPTITLMQETR 305

  Fly   462 VFGWVDLMVSFGGIAGLFLGCSLISGMELAYFL 494
            ....:|::...||.:.||:|||.::.||:..||
 Worm   306 KTTLIDILCYLGGASSLFMGCSCVTLMEMFVFL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 22/95 (23%)
del-5NP_509838.2 ASC 66..337 CDD:295594 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.