DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and del-5

DIOPT Version :10

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:98 Identity:24/98 - (24%)
Similarity:47/98 - (47%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 EFVRNQFQGMSCKCFRNCYSLNY---ISDVRPAFLPPDVYANNSYVDLDVHFR-FETIMVYRTSL 461
            |:::..|     .|:.:|..:.|   .|.:|        ::::|.|   :.|. ..||.:.:.:.
 Worm   257 EYLQYDF-----PCYPSCSEIKYQVSKSKLR--------HSSDSVV---ITFSVLPTITLMQETR 305

  Fly   462 VFGWVDLMVSFGGIAGLFLGCSLISGMELAYFL 494
            ....:|::...||.:.||:|||.::.||:..||
 Worm   306 KTTLIDILCYLGGASSLFMGCSCVTLMEMFVFL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:459966 22/95 (23%)
del-5NP_509838.2 ASC 66..>124 CDD:459966
ASC <263..337 CDD:459966 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.