DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and degt-1

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:343 Identity:67/343 - (19%)
Similarity:120/343 - (34%) Gaps:85/343 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RFGKRTTIHGLDRLLSAKASRWERFVWLCTFVSA-FLGAVYVCLILSARYNAAHFQTVVDSTRFP 100
            ||.:.|::.|. |.|..:...|.|.:|  .||.. |:|..:..:.....|   :|.....:||..
 Worm    43 RFAEDTSMLGF-RYLHTRYKTWFRVLW--GFVVVFFIGLTFYQVFERVTY---YFIKNPLTTRRS 101

  Fly   101 VYRIP---FPVITICNRNRLNWQRLAEAKSRFLANGSNSAQQELFELIVGTYDDAYFGHFQSFER 162
            ...:|   ||.|.:||:.::....:| :|:..|..|..|...|      .:.:.:.|.....|: 
 Worm   102 YETLPNMYFPTIGVCNKMQIKASSVA-SKNPDLLRGMCSVLDE------SSSNSSRFDELDKFD- 158

  Fly   163 LRNQPTELLN-YVNFSQVVDFMTWRCNELLAECLWRHHAYDCCEIFSKRRSKNGLCWAFNSLETE 226
                ..::|: |.|..|..|       :|...|.:.... .|.:......:..|||::.:..:| 
 Worm   159 ----DVDILSLYRNSFQSAD-------DLFVSCEFGKSG-SCQDEIRPIYTPFGLCYSVSPNKT- 210

  Fly   227 EGRRMQLLDPMWPWRTGSAGPMSALSVRVLIQPAKHWPGHRETNAMKGIDVMVTEPFV------- 284
                  :|.|         ||.:.||:.:.::..:..||            .|.||.|       
 Worm   211 ------ILRP---------GPETTLSLVLNLEVHEIIPG------------TVVEPGVVLSIYDG 248

  Fly   285 -----WHNNPFFVAANTETTMEIEPVIYFYDNDTRGVRSDQRQCVFDDEHNSKDFKSLQGYVYMI 344
                 .::....:.|....|:.:        |:.|.:|..:..|      .|...:|.....|..
 Worm   249 ASSLSHYSEGIHLEAGKVVTIPV--------NEVRKLRLHESSC------GSTKMESFSEKEYSK 299

  Fly   345 ENCQSECHQEYLVRYCNC 362
            ..|:.....:.:.:.|.|
 Worm   300 AACEWSVSVKQIEKECGC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 66/342 (19%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 66/342 (19%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.