DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and scnn1gl

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_017947701.2 Gene:scnn1gl / 101734161 XenbaseID:XB-GENE-22061126 Length:481 Species:Xenopus tropicalis


Alignment Length:489 Identity:103/489 - (21%)
Similarity:181/489 - (37%) Gaps:141/489 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VWLCTFVSA-FLGAVYVCLILSARYNAAHFQTVVDSTRFPVYRIPFPVITICNRNRLNWQRLAEA 125
            :|.|:.::| ||           ||......|:|:|.     |:|||.||.||.||....:|..:
 Frog     2 LWQCSQLTATFL-----------RYPTQEKVTLVNSA-----RLPFPAITFCNLNRARMSKLNSS 50

  Fly   126 K----SRFLANGSNSAQQELFELIVGTYDDAYFGHFQSFERLRNQPTELLNYVNFSQVVDFMTWR 186
            |    :.:|:..|.:..:|      |:.......:| :|...:..|.|.:.          :..:
 Frog    51 KYQSLTEYLSFTSGNESEE------GSISHGRDRNF-TFALSQLTPQEQME----------LGHQ 98

  Fly   187 CNELLAECLWRHHAYDCCEIFSK--RRSKNGLCWAFNSLETEEGRRMQLLDPMWPWRTGSAGPMS 249
            ...:|..|::  |...|.|.|..  ...|.|:|:.||      |||...|               
 Frog    99 LENMLISCIF--HDEVCNESFFTPFLNPKLGICYTFN------GRRQADL--------------- 140

  Fly   250 ALSVRVLIQPAKHWPGHRE---TNAMK-GIDVMVT-EPFVWHNNPFFVAANTETTMEIEPVIY-- 307
                       :||..:::   .||.| |....:| |.|:..:.   ..::..||..:..|::  
 Frog   141 -----------QHWQNYQQEEYLNATKAGFSYGLTMELFIEQSE---YISSLSTTAGLRVVLHGQ 191

  Fly   308 ----FYDNDTRGVRSDQRQCV---------FDDEHNSK-----DFKS----LQGYVYMIENCQSE 350
                |.:::...|...|...:         ..:.::||     |.::    :.|..|..|.|:..
 Frog   192 GKMPFPEDEGVNVPPGQESDIGIVKVHVKRLQEPYSSKCSNGNDIRNFYTDVYGTDYSRETCKKS 256

  Fly   351 CHQEYLVRYCNCTM-DLLFPPGQYRSCRAQDLLC-LAEHNDLLIYSHNPGEKEFVRNQFQGMSCK 413
            |.|..:::.|.|.| :...|||      :...|| ::|.:    .:|.....|:..:..| :.|.
 Frog   257 CAQAKMIKNCGCRMWEFPEPPG------SNVPLCNISEPS----VNHCVEMYEYKLSHDQ-LKCH 310

  Fly   414 CFRNCYSLNYISDVRPAFLPPDVYANNSYVDLDVHFRFET----------IMVYRTSLVF----- 463
            |...|....:...:..:..|..:|.::....|.....|::          ::||...|.:     
 Frog   311 CPLQCEEEIFELTLSSSQWPSSMYLDSFTKRLQSRKGFQSAQSIRDNVVKVVVYYQQLNYELIEE 375

  Fly   464 ----GWVDLMVSFGGIAGLFLG---CSLISGMEL 490
                ..|||..|.||:.||::|   |::...:||
 Frog   376 VPSMQLVDLFSSIGGLVGLWIGVSVCTVAEFLEL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 103/489 (21%)
scnn1glXP_017947701.2 ASC 1..450 CDD:413546 103/489 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.