DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk7 and asic4

DIOPT Version :9

Sequence 1:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster
Sequence 2:XP_031749131.1 Gene:asic4 / 100486325 XenbaseID:XB-GENE-940165 Length:535 Species:Xenopus tropicalis


Alignment Length:512 Identity:116/512 - (22%)
Similarity:195/512 - (38%) Gaps:98/512 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QQQQQPSRSSRLAQQLAQSSWQLALRFGKRTTIHGLDRLLSAKASRWERFVWLCTFVSAFLGAVY 76
            :::::..|.|.:..::..:...|| .|...:|:|||..:........::.:|...|:::.|..:|
 Frog    19 KEKEEGERESLIGDEVPAAGRDLA-AFASTSTLHGLRHIFQTGRLGIKQSLWALAFLASLLFFLY 82

  Fly    77 VCLILSARYNAAHFQTVVDSTRFPVYRIPFPVITICNRNRLNWQRLAEAKSRFLANGSNSAQQEL 141
            .....:..|......|.||..  .:..:.||.|||||.||.....|.:.....|||         
 Frog    83 QVAKCALYYLEHPHVTAVDEE--VMGEMIFPAITICNINRFRHSALTDPDIYHLAN--------- 136

  Fly   142 FELIVGTYDDAYFGHFQSFERLRNQPTELLNYVNFSQVVDFMTWRCNELLAECLWR-HHAYDCC- 204
               :.|.......||..| :.:.:.| ::|:.||          |....|||.|.. :.:.|.| 
 Frog   137 ---LTGLPPKDREGHRDS-DLMYDDP-DMLDIVN----------RTGHQLAEMLKSCNFSGDSCS 186

  Fly   205 -EIFSKRRSKNGLCWAFNSLETEEGRRMQLLDPMWPWRTGSAGPMSALSVRVLIQPAKHWPGHRE 268
             :.||...::.|.|:.||:            |...|..:...|..:.|.:.:.||..::.|..||
 Frog   187 AQNFSVVFTRYGKCYTFNA------------DKKHPKVSRQGGMGNGLEIMLDIQQEEYLPIWRE 239

  Fly   269 TNAMK---GIDVMV---TEPFVWHNNPFFVAANTETTMEIEPVIYFYDNDTRGVRSDQRQCVFDD 327
            ||...   ||.|.:   .||...|...|.|:...:|.:..:.....|.....|   :.|..:..:
 Frog   240 TNETSFEAGIRVQIHSQDEPPYIHQMGFGVSPGFQTFVSCQEQRMTYLPQPWG---NCRSSIPGE 301

  Fly   328 EHNSKDFKSLQGY-VYMIENCQSECHQEYLVRYCNCTMDLLFPPGQYRSCRAQDLLCLAEHNDLL 391
            |.       |.|| .|.|..|:.:|.:|.::|.|.|.|  :..||....|.....:| |:|    
 Frog   302 EF-------LSGYSTYSISACRLQCEKEAVIRKCACRM--VHMPGNETICSPVMYMC-ADH---- 352

  Fly   392 IYSHNPGEKEFVRNQFQGMS--CKCFRNCYSLNYISDVRPAFLP--------------PDVYANN 440
                      .:.|..:..|  |.|...|....|..::....:|              .:.|...
 Frog   353 ----------ILDNMVEDTSEKCSCPTPCNLTRYSKEISMVRIPNKGSARYLARKYNKNETYIRE 407

  Fly   441 SYVDLDVHF---RFETIMVYRTSLVFGWVDLMVSFGGIAGLFLGCSLISGMELAYFL 494
            :::.||:.|   .:|||   .....:....|:...||..|||:|.|.::.:|:..::
 Frog   408 NFLVLDIFFEALNYETI---EQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYM 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk7NP_609016.2 ASC 38..493 CDD:279230 112/483 (23%)
asic4XP_031749131.1 ASC 39..514 CDD:413546 114/492 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48391
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.