DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and pkdc

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:259 Identity:54/259 - (20%)
Similarity:94/259 - (36%) Gaps:72/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 RLDILSRGDTFGAKYYHSVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSM 176
            |:.:.....:||.:         |.||..||.|.||.|  |:..::.......|..:..|||..:
Zfish    94 RVPLCLAAKSFGEE---------QLIVLEDLDVAGFPV--RKTYVNDAEIKACLSWIANFHALFL 147

  Fly   177 VLAKKDPAIVKQY----TRGMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLM 237
            .:..:....:..|    ||   .|::...||.           .:|::|.             .:
Zfish   148 DVTPEGLWPIGTYWHLETR---PEELEAMSDQ-----------KLKAAAG-------------EI 185

  Fly   238 DNFRNVCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDL 302
            |:..|.|          |:..:.|||....||.:..|.       .:...||||....|....|:
Zfish   186 DSILNNC----------RFKTIVHGDAKLANFCFSKDG-------LQVASVDFQYVGGGCGMKDV 233

  Fly   303 NFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQYELRSRETYGLFGMFAF 366
            .:||.:.:..:..:::...|:..|::..:.:||..     ..:.:|:.|.|:        ||||
Zfish   234 IYFLGSCMDERECEKKAPGLLDYYFSELRKSLEKK-----VDFAELEKEWRN--------MFAF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 47/230 (20%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 45/225 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.