DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG10550

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:429 Identity:107/429 - (24%)
Similarity:192/429 - (44%) Gaps:48/429 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKNEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADG 68
            :...:::.:|:::||.:|...:|:.:......:..:..| .:.||:||.|.:.||.|... ..||
  Fly    11 VNPNEHLHIPKWINEEYFQPIIEKDVENFDKIINLVPIA-ATAPGENYTSIMIRVIVDIL-LKDG 73

  Fly    69 GESPVTEQLSLIVKT-IPITEATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKT 132
            .|    :::|.|:|| :........::.:.:|.||::.|...:|:.          .|.|.....
  Fly    74 SE----QRVSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQF----------VKLYKEAGL 124

  Fly   133 PVQ---------------TIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKD 182
            .::               |:||.||:.:.||...|.||.|..|...:|::|.:.||.|:|..:.:
  Fly   125 EIELAPKCLHVDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEIN 189

  Fly   183 PAIVKQYTRGMLSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADA 247
            ......|...:.:|   ...|.||.:.....:..:|:..:| ..|....::.|:.|.. .|..:|
  Fly   190 GPYDAMYNMSIYNE---QSRDLFESLGKQREEQFLKAMRNW-DLENAESYIARMWDPL-EVFEEA 249

  Fly   248 PRPRK--GDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSI 310
            .:..:  .|.:.||||||.|:||.|:.|.:..:.|   |.|.||.|:..:||||.||.:.:.||.
  Fly   250 VQVNQVDEDEFNVLNHGDCWSNNIMFNYKDNGEID---RTILVDLQVGKWGSPAQDLWYLITTSA 311

  Fly   311 KLQLLQERREELIKVYYASFKDALEYARF-EDIPSYEDLQYELRSRETYGLFGMFAFLPMITMPK 374
            .|.:..:..:..|::|:....:.|:...: :.||:..||...:..   ||.:|  ....|..|..
  Fly   312 SLDIKIKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLK---YGFWG--PLTAMGVMVA 371

  Fly   375 ELAQDNSIENMQDEAFKQRKMDAIFSQKFLNDHQKWALK 413
            .|...:...||:....:..:.|||..:.|:|.:...|:|
  Fly   372 TLMPTDKDANMKMILAQGPEADAIRYRTFINPYYAKAMK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 82/309 (27%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 82/309 (27%)
APH 108..338 CDD:279908 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.