DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG13658

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:440 Identity:115/440 - (26%)
Similarity:194/440 - (44%) Gaps:51/440 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGE 70
            |...:..|.:||.......|....::.::.:.::..:..:..||:|.|.::| .||....|.|..
  Fly    11 NADEVDAPAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFR-AVSHYSTAKGNF 74

  Fly    71 SPVTEQLSLIVKTIPITEA--TQFLEDVCVFIKEKQTYTDVLPRLDILSR--GDT---FGAKYYH 128
            |.     :|||||:|..|.  ...|.:..:|..|...|:..||.|:.:.|  |||   :....||
  Fly    75 SK-----ALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYH 134

  Fly   129 SVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGM 193
            |:: |.|.::|.||..:|:.|. |::..:.........:|.|:||.||.:..:.|..:|::..|:
  Fly   135 SLE-PHQVMIFEDLVPQGYTVI-RDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGL 197

  Fly   194 LSEDILMKSDTFEQMFGGFLKGL--IKSSASWAGY-EKIS----KHLQRLMDNFRNVCADAPRPR 251
            ......:...........||:.|  :.....:..| |||.    :.:..:|:.:|.    .|:| 
  Fly   198 WGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRT----NPKP- 257

  Fly   252 KGDRYVVLNHGDLWTNNFMYGY--DNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQL 314
              :||.||.|||....|.|:.|  :..|..||    :.||||:    |..|.|:..|..||.:.:
  Fly   258 --NRYYVLCHGDFHGRNMMFRYNKETGSFEDV----MLVDFQI----SNVCPLSIDLIYSIFMVM 312

  Fly   315 LQERR----EELIKVYYASFKDALEYARFE-DIPSYEDLQYELRSRETYGLFGMFAFLPMITMPK 374
            ..|.|    :|.|..|::...|.|:...|: ::|:...:...:...:.|..|.|.:|||::.   
  Fly   313 DTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVA--- 374

  Fly   375 ELAQDNSIENMQDEAF-KQRKMDAIFSQKFLNDHQKWALKRADSLGVFGD 423
              |.:.......|..| .|.|..:.|..:::.| .|..|::.:.||.|.|
  Fly   375 --AMNTKTFKSMDSFFDPQTKQKSFFLDEYITD-VKMLLRKFEELGYFKD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 89/311 (29%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 89/311 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.