DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG14314

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:411 Identity:92/411 - (22%)
Similarity:157/411 - (38%) Gaps:100/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIP--ITEATQFL 93
            |..|.:.....|.||:.||||.:|:||:.::      |....:..:.::|.|.:|  :.....:.
  Fly    39 EPDVQIDAFELAQGSDRGDNYTAALYRIKLT------GKRRSLKWEQNVICKVMPESVVAREAYK 97

  Fly    94 EDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPV------------QTIVFSDLTVEG 146
            .|. :|..|.|.|..::|.|.......|       :..|||            ..::..||...|
  Fly    98 SDK-LFRNEVQFYNTIMPELLKFQASKT-------NQDTPVFNAIPKCYSARHDLLIMEDLRERG 154

  Fly   147 FKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTR--GMLSEDILMKSDTFEQMF 209
            |:::.|.|||.......:|.|:.:.|..|:....:.|.   :::.  .|:||.|...::|     
  Fly   155 FQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPL---EFSNLCSMISEGIFCTANT----- 211

  Fly   210 GGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADAPRPRKGDRYVV---------------- 258
                        ||     ...:.:||..|...:.::...|  ..:||:                
  Fly   212 ------------SW-----YRNYYERLTKNAIQMVSEVLPP--DSKYVLAMNKFAESSSFFGRMV 257

  Fly   259 -----------LNHGDLWTNNFMYGYDNASQPDVPTRAI---FVDFQLSFYGSPACDLNFFLNTS 309
                       :.|||.|.|||:|.||    |:.|.|.:   .:||||..|.|.|.|:...|...
  Fly   258 KLASTESPLSAICHGDCWVNNFLYHYD----PEDPHRVLEVALLDFQLIRYSSIALDIANLLYCC 318

  Fly   310 IKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQYELR-----SRETYGLFGM---FAF 366
            ...::...:.:.|:|:|.......|:.. ..::|.:.|...:|:     ..:|||.|.:   ...
  Fly   319 TTKEMRDAQLQTLLKIYTEELFRWLQML-CTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDI 382

  Fly   367 LPMITMPKELAQDNSIENMQD 387
            ||:.|...|.|.|..::...:
  Fly   383 LPISTCSSEDAPDMYLDRSDE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 74/337 (22%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 74/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.