DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and F59B1.10

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:429 Identity:97/429 - (22%)
Similarity:161/429 - (37%) Gaps:134/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TEATQFLEDVCVFIKEKQTYTDVL---PRLDILSRGDTFGAKYY-----------HSVKTPVQTI 137
            |..|.|  ||...|||:.:....|   .:::::..|:.|.::..           |..|..:..|
 Worm    18 THVTLF--DVNKAIKEQMSTESELTAESKMEVIGDGNGFSSRVLLISCNWTIPSAHLPKKLILKI 80

  Fly   138 VFSDLTVEGFKVASREKGLDWNHASLILQQL--------------------------GKFHATSM 176
            | |.:.::    |..:||...| ||||.:::                          |||::.::
 Worm    81 V-SFVHIQ----ALIDKGKQQN-ASLITKEVEEQMYAYFESSCKKMHNQEMNFYEVAGKFNSKTL 139

  Fly   177 VLAK------------KDPAIVKQYTRGML---SEDILMKSDTFEQMFGGFLKGLIKSSA-SWAG 225
            ::.|            ....|..:|..|.:   |.|    :.|.|:: ...|:.:.|..| |...
 Worm   140 LIPKVYFYTKLDEKNSNKGFIGMEYVEGSIVRHSYD----TCTIEEI-QPILRAIAKLQALSLQN 199

  Fly   226 YEKISKHLQRLMDN---FRNV----------------CADAPRPRKGD----------------- 254
            ..:|||.||:: ||   |:..                |.:..|.|.|:                 
 Worm   200 PAEISKDLQKI-DNGAIFQETLKMMLSESGIKGIFEQCRNLERSRFGEKVDRIEEKRNEILDFEK 263

  Fly   255 ----------RYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTS 309
                      :..||.|||||..||::..:|.    |......||:|:|..|:||.||...|.::
 Worm   264 AFNLNKVVGIKQNVLCHGDLWAANFLWTENNG----VFCATRIVDYQMSHLGNPAEDLVRLLVST 324

  Fly   310 IKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQYELRSRETYGLFGMFAFLPMITMPK 374
            |.....|...:::::.:|:.|.:  |....|...:.|.|:.   |.:.|...|..|.||:...  
 Worm   325 ITGADRQAHWQQILEQFYSYFLN--ELGSGEAPYTLEQLKL---SFKLYFPVGALALLPLFGP-- 382

  Fly   375 ELAQDNSIENMQDEAFKQRKMDAIFSQK---FLNDHQKW 410
              |.|..:|.|..|  |..|...:..:|   .|:|.:|:
 Worm   383 --AVDAKLEGMDSE--KAEKCRHVVIEKVACLLDDLEKY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 77/353 (22%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 97/429 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.