DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG33509

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:351 Identity:83/351 - (23%)
Similarity:149/351 - (42%) Gaps:48/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFA---RWADGGESPVTEQLSLIVKTIPITE 88
            |..:||.|.:|.:::....:     .|||..:|..:|   |:.. .|..:..::.|.||.:|...
  Fly    12 ENAQESAVRVKLLDYHLVRD-----LSAIGYLGDYYALTLRYCH-EEEEIIREIELFVKAMPQQS 70

  Fly    89 ATQFLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYY-HSVKTPVQTIVFSDLTVEGFKVASR 152
            |.  |....:|.||...|..::.:|..||     ..|:. :.|.:....:|..::.::||..|..
  Fly    71 AE--LSKESIFQKESWLYDTLIKKLQALS-----NVKWSPNCVYSRKDLMVLENIKLKGFTSAGS 128

  Fly   153 EKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILMKSDTFEQMFGGFLKGL- 216
            .: |:......:::.:..||:.|:|...:....: .:|.|    |.|::. |.:.....|..|| 
  Fly   129 AE-LNEVFVKPLIKSIAAFHSASLVYEHQTKTNI-GHTYG----DNLLEI-TVDSEIAWFTTGLS 186

  Fly   217 -----IKSSASWAGYEK---ISKHLQRLMDNFRNVCADAPRPRKGDRYVVLNHGDLWTNNFMYGY 273
                 ::|.|.:.|..:   |...|..:|:......|.:.:.|.     ||.|.|:|..|..:..
  Fly   187 AVLAVVRSLAKYQGNREQSFIGDKLMGIMETIYEQAAPSKKYRN-----VLCHRDIWAGNIFFPP 246

  Fly   274 DNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYAR 338
            :|:..      |:.:|||...|..||.||||.|..::.....::..::.|.:|:......|....
  Fly   247 ENSGP------ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLG 305

  Fly   339 FED-IPSYEDLQYELRSRETYGLFGM 363
            .|: :.|..:|   |.|.|.:.|||:
  Fly   306 LEELVISKSEL---LESYEEFRLFGV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 69/304 (23%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 61/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459277
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.