DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG33510

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:387 Identity:95/387 - (24%)
Similarity:149/387 - (38%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LIVKTIPITEATQ--FLEDVCVFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQTIVFSD 141
            |.||::....|..  ::|.:.:..||.:.| |:|..|...|: ..:.||.|.:.|.     :|..
  Fly    79 LFVKSVIFQNANMEFYMEKMGLIEKEIKLY-DLLNELKKFSK-HVWSAKCYFTRKD-----LFVM 136

  Fly   142 LTVEGFKVASREKG---LDWNHASLILQQLGKFHATSMVLAKK------------------DPAI 185
            ..||.....:...|   |:.|....||:.|...||:|:...|:                  ||. 
  Fly   137 QNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVDPE- 200

  Fly   186 VKQYTRGM--------LSEDILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRN 242
            |:.||.|:        :..|:|...:                     ..|.|::.|.|.:|  :.
  Fly   201 VEWYTTGLRAVLAVAAIHPDVLDNPE---------------------AQEYIAQELPRCLD--KV 242

  Fly   243 VCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLN 307
            .|...|.|...:.:|   |.|.|..|..|..:...:    .|:|.|||||..|..||.|  |.|.
  Fly   243 YCMVNPSPVHRNVFV---HRDAWNANVFYHKEKPHE----ERSILVDFQLCRYSPPAMD--FHLV 298

  Fly   308 TSIKLQLLQERR--EELIKVYYASFKDAL--EYARFEDIPSYEDL---QYELRSRETYGLFGMFA 365
            |.:.|:....::  ..||:.||    |||  |:......|..|.|   ::| :|...:.|||  |
  Fly   299 TYLNLEPFSRKKMIGSLIETYY----DALAEEFREMGVNPYQEQLSKQEFE-QSLNDFSLFG--A 356

  Fly   366 FLPMITMPKELAQDNSIENMQDEAFK--------QRKMDAIFSQKFLNDHQKWALKRADSLG 419
            ....|........||.::|::||..:        .|..|.:   :.:.:|.::|....|.:|
  Fly   357 TYNCIAATVLRLPDNYLKNLKDERPEDFHRFCNVDRSADVL---RLMKNHPEFADYMYDCVG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 74/294 (25%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459278
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.