DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG33511

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:265 Identity:62/265 - (23%)
Similarity:116/265 - (43%) Gaps:18/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSLIVKTIPITEATQFLEDVC----VFIKEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQTI 137
            |:..:|::|.....|  .:.|    ||.||...|:.:||::...:....:...||    :....:
  Fly    64 LNYFIKSLPRKNEPQ--REECERKGVFQKESALYSQILPKIQKYATKKLYPKCYY----SRNDIL 122

  Fly   138 VFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILMKS 202
            |..||| :.::.....:....:|..::|:.|.:.||.|:...:|:...:.:..:.:|.|   :..
  Fly   123 VLEDLT-QDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIE---LHL 183

  Fly   203 DTFEQMFGGFLKGLIKSSASWAGYE--KISKHLQRLMDNFRNVCADAPRPRKGDRYVVLNHGDLW 265
            |:....:...||.::..:|....::  |....:|..:.|......:...|.|..|. ||.|.|.|
  Fly   184 DSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRN-VLCHRDTW 247

  Fly   266 TNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASF 330
            .:|.:| |.|.....:|.....|||||:.|.||..|:.|.|......::.:...:|.::.||.:.
  Fly   248 DHNIVY-YFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNL 311

  Fly   331 KDALE 335
            :..|:
  Fly   312 QHHLD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 62/265 (23%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.