DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG5126

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:412 Identity:91/412 - (22%)
Similarity:153/412 - (37%) Gaps:79/412 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SNPGDNYCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQFLEDVCVFIK---EKQTY 106
            ||..|.:.||:|.|.:....    .|...||  .::||.:..||  :|.|....:|:   |...|
  Fly    37 SNGLDGFMSALYTVTLDVVI----AERKRTE--VVLVKFMKGTE--EFRESSNSYIQFSNEIFAY 93

  Fly   107 TDVLPRLDILSRGDTFGAKYYHSVKTPVQTIVFSDL-TVEGFKVASREKGLDWNHAS-------- 162
            .::||..:.:.|.....::.   ||..|....|:.. .|||.. ..||..|...|..        
  Fly    94 AEILPAYENVLRTSHLESEV---VKNWVPCCYFARFGHVEGLG-NGRESVLALKHLKGDGYQLGP 154

  Fly   163 -LILQQ---------LGKFHATSMVLAKKDPAIVKQYTRGMLSEDILMKS-------------DT 204
             |.|::         :|.|||.........|.:..:...|::....:..|             |.
  Fly   155 RLTLRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAFDR 219

  Fly   205 FEQMFGGFLKGLIKSSASWAG------YEKISKHLQRLMDNFR--NVCADAPRPRKGDRYVVLNH 261
            |.:.:....:.|::.:....|      .||..|....|::..|  :...|.|    ...:....|
  Fly   220 FYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSFAEDQP----DSHFATFLH 280

  Fly   262 GDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVY 326
            ||...||.::.|....:.|. .:||  |||...:.:.|.||:||:..:...:..:|...:|::.|
  Fly   281 GDYNRNNVLFHYGAEDKVDA-IKAI--DFQELRFSTTAIDLSFFMYMNTPSEGRKEIYADLLRKY 342

  Fly   327 YASFKDALEYA-----------RFEDI---PSYEDLQYELRSRETYGLFGMFAFLP-MITMPKEL 376
            :.|..:.||..           |.:.:   .|:|......:....||......||| ::...|:.
  Fly   343 HRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDC 407

  Fly   377 AQDNSI--ENMQDEAFKQRKMD 396
            |:.:.:  .:|...||.|..:|
  Fly   408 AELSRLFETDMHGPAFHQLSLD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 74/345 (21%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 74/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.