DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG31974

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:405 Identity:107/405 - (26%)
Similarity:165/405 - (40%) Gaps:64/405 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKNEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADG 68
            |||     :|:.:..|     |.||     .||...:.::.:.|||||.|.:..|.... |.|||
  Fly     7 IKN-----LPQVIEPH-----LPEG-----CTLDSYSTSYLTKPGDNYGSIMLSVQAKI-RSADG 55

  Fly    69 GESPVTEQLSLIVKTIPITEAT--QFLEDVCVFIKEKQTYTDVLPRLDILSRG---------DTF 122
            |    ...|.||.|..|:|...  |..:.....|.|...|..:.|.||.|...         |.|
  Fly    56 G----IRDLPLIAKLPPLTNDLYWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGF 116

  Fly   123 GAKYYHS------VKTPVQ---TIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVL 178
             .:||.|      ..|.|.   .:|..::|..|::..:|.:..:.....|||..|.::||..:.|
  Fly   117 -PRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIAL 180

  Fly   179 AKKDPAIVKQYTRGMLSE-DILMKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFR- 241
            ..|.|.:.::|.|....: |:....|..|...  ..|.::|........|:....::.|:|.|: 
  Fly   181 RLKKPQVYEEYVRPYFKKFDMNSNIDQAETEI--MNKEILKDIKLVTSDERDVNRVKELLDIFQA 243

  Fly   242 ----NVCADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDL 302
                |...|.|       :..|.|||||.||.|..|....:...|.:...||||::.|||...|:
  Fly   244 FQASNDVDDGP-------FTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDI 301

  Fly   303 NFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSY------EDLQYELRSRETYGLF 361
            .|.|.:|:.:.:|::.....:.:||.:|...|..... |..:|      |::|.....:..:.:|
  Fly   302 IFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNV-DTSNYTYELFLEEVQQTAHVQLPHAIF 365

  Fly   362 GMFAFL-PMITMPKE 375
            .|...| ...|:||:
  Fly   366 MMKVILADNSTIPKD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 87/317 (27%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 87/316 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.