DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG7135

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:422 Identity:153/422 - (36%)
Similarity:239/422 - (56%) Gaps:27/422 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPVTEQL 77
            |.||...||..|||.||::..:.:..:.....:..|:||||.|||..:.:.    ..||...| .
  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYR----NAESCAME-T 68

  Fly    78 SLIVKTIPITEATQFLEDVCVFIKEKQTYTDVLPRLDIL--SRGDTFGA-----KYYHSVKTPVQ 135
            |||||::| .|....|..:.::.||...|..:.|:|:.|  ...|:|.|     |:|:|...|.|
  Fly    69 SLIVKSMP-DEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQ 132

  Fly   136 TIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDP-AIVKQYTRGMLSEDIL 199
            ||:..||...|:::..|:.|||::||:|::.:|.::||.:||:|:::| .||.:|..|:|..|.:
  Fly   133 TIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAI 197

  Fly   200 MKSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADAPRPRKGDRYVVLNHGDL 264
             .|:.|:.:||..|..|........|:..|:..|.|..::|......|..|.:|: :.|||||||
  Fly   198 -NSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGN-HNVLNHGDL 260

  Fly   265 WTNNFMYGYD---NASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVY 326
            |.||..:.||   ...|..:      :||||.||||...|:|:|||||::|::|::||:||:.:|
  Fly   261 WVNNIFFKYDAEYTVQQVKI------IDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIY 319

  Fly   327 YASFKDALEYARF-EDIPSYEDLQYELRSRETYGLFGMFAFLPMITMPKELAQDNSIENMQDEAF 390
            |.|..|.|::..: :::|||||:..|:|.||.||.|..|.|.|:::|....::|||::|..||.|
  Fly   320 YRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETF 384

  Fly   391 KQRKMDAIFSQKFLN-DHQKWALKRADSLGVF 421
            .::|:..:|...... :..|..|||.|.|.:|
  Fly   385 ARQKVQLMFEGNTRTLESLKCTLKRLDELKLF 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 111/302 (37%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 111/300 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449674
Domainoid 1 1.000 151 1.000 Domainoid score I8921
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I6336
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 1 1.000 - - mtm9697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
1110.910

Return to query results.
Submit another query.