DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG31300

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:446 Identity:119/446 - (26%)
Similarity:191/446 - (42%) Gaps:67/446 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NEQNISVPEYLNEHFFTETLE--EGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGV-------S 61
            |:..:..|.:||..|..|.|.  |...|.||.  ::.....|..||:|.|.::|...       .
  Fly    11 NDDELEAPAWLNRQFIEEILSAYEDSPELKVV--DLKITPASAQGDHYASVMFRTTAECTTAKGK 73

  Fly    62 FARWADGGESPVTEQLSLIVKTIPITEA--TQFLEDVCVFIKEKQTYTDVLPRLDILSR--GD-- 120
            |:|             .||:|.:|..:.  ...|.:..:|..|...|..|||..:.:.|  ||  
  Fly    74 FSR-------------PLIIKAMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDT 125

  Fly   121 -TFGAKYYHSVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPA 184
             .|....|||:: |.:.::|.||..:|:.|. |::.:..........:|.|:||.||...|:.|.
  Fly   126 KLFVPCIYHSLE-PRKVMIFEDLVPQGYYVI-RDRPVAQEELKTAFAKLAKWHAISMKYIKEQPD 188

  Fly   185 IVKQYTRGMLSEDILMKSDTF----EQMFGGFLKGLIKSSASWAGYEKI-SKHLQRLMDNFRNVC 244
            .:|::..| |.|...:|:|.|    .|.|...|..|.:.......:||| .|::|||    :.|.
  Fly   189 FLKEFKYG-LFEMPTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRL----QAVM 248

  Fly   245 ADAPRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTS 309
            .:....||.|.:.||.|||....|.|:..:..:.....|  :.||||:    |..|.:...|..|
  Fly   249 KEYHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDT--MLVDFQI----SNLCPITIDLTYS 307

  Fly   310 IKLQLLQERREEL--------IKVYYASFKDALEYARFEDIPSYEDLQYELRSRETYGLFGMFAF 366
            |.:.:..|:|.|:        :.|..|:.| ::.|.  .::|:...|..|:...:.|..|.:..|
  Fly   308 IYMLMEPEQRREMGKDLINHYLTVLVATLK-SIGYP--GELPTQAKLWDEIHKNKYYDFFLLSTF 369

  Fly   367 LPMITMPKELA-QDNSIENMQDEAFKQRKMDAIFSQKFLNDHQKWALKRADSLGVF 421
            ||:|...|..: :.|.:  :||...:|:   ..|...::.|..| .|.:.:.||.|
  Fly   370 LPLILAIKSKSFKVNDL--IQDPETRQK---TYFLDTYVKDVSK-LLPKFEQLGYF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 86/318 (27%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 85/315 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.