DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9498 and CG31102

DIOPT Version :9

Sequence 1:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster


Alignment Length:382 Identity:96/382 - (25%)
Similarity:176/382 - (46%) Gaps:36/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDNYCSAIYRVGVSFARWADGGESPV 73
            ::.:|.::||.:|...|:...||.:..| .::....:.||:.|.|.:.|:.:.. ...||    .
  Fly    13 DVRIPAWINEAYFKRLLKREFREFRRIL-NLSIIPATPPGETYTSLLMRIVIDI-ELKDG----F 71

  Fly    74 TEQLSLIVKTIPITEAT---QFLEDVCVFIKEKQTYTDVLPRLDIL----SRGDTFGAKYYHS-- 129
            ::|.|.||||: :.:|.   .|:..:.:|.|||..|..::|.|:.|    .....|..|.:|:  
  Fly    72 SQQKSYIVKTM-LDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAED 135

  Fly   130 VKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGML 194
            :|..: .:|..||..:.::..:|.||.|..|...:|::|.:|||...|..::.......:.|..|
  Fly   136 IKGRI-CLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYL 199

  Fly   195 SEDILMKSDTFEQMFGGFLKGLIKSSASW--AGYEKISKHL---QRLMDNFRNVCADAPRPRKGD 254
            ..: ..||.:::.....:...:    |||  |.:|:....:   .:.:.::.:...:.|:     
  Fly   200 PAN-YQKSKSYQARLQSYKTAI----ASWGLADHEQYVSRIPTADQFVQSYASCFNNNPQ----- 254

  Fly   255 RYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERR 319
            .:.||||||.|::|.|..|....  |: .:..||||||..:||||.||...:..|.:..:..:..
  Fly   255 EFKVLNHGDFWSSNIMLSYTQTG--DI-NQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYF 316

  Fly   320 EELIKVYYASFKDALEYARF-EDIPSYEDLQYELRSRETYGLFGMFAFLPMITMPKE 375
            :..|::|:......|:..:: |.||...:|...:.....:|.|..|..|..|.:|.:
  Fly   317 DYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 78/305 (26%)
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 78/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.